Detailed information NTG0000666

Experimentally validated

Overview

• Name: ymcA
• Type: Regulator
• Locus tag: BSU_17020
• Genome accession: NC_000964
• Coordinates: 1774374..1774805 (+)
• Length: 143 a.a.
• NCBI ID: NP_389584.1
• Uniprot ID: -
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: accelerate the production of Spo0A~P Competence regulation

Function

YmcA and YlbF interact with a third protein, YaaT to form a tripartite complex. The YmcA-YlbF-YaaT complex affects the phosphotransfer between Spo0F and Spo0B, thus accelerating the production of Spo0A~P.

Genomic Context

Location: 1769374..1779805

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_16980 (BSU16980)	spoVS	1769935..1770195 (+)	261	NP_389580.1	regulator required for dehydratation of the spore core and assembly of the coat (stage V sporulation)	-
BSU_16990 (BSU16990)	tdh	1770461..1771504 (+)	1044	NP_389581.1	threonine 3-dehydrogenase	-
BSU_17000 (BSU17000)	kbl	1771517..1772695 (+)	1179	NP_389582.1	2-amino-3-ketobutyrate CoA ligase (glycine acetyl transferase)	-
BSU_17010 (BSU17010)	miaB	1772843..1774372 (+)	1530	NP_389583.1	enzyme for ms(2)i(6)A formation for tRNA modification	-
BSU_17020 (BSU17020)	ymcA	1774374..1774805 (+)	432	NP_389584.1	master regulator for biofilm formation via regulation of RNase Y (RicAFT complex / FAD / two [4Fe-4S]2+)	Regulator
BSU_17030 (BSU17030)	cotE	1775067..1775612 (+)	546	NP_389585.1	morphogenic spore protein	-
BSU_17040 (BSU17040)	hexA	1775745..1778321 (+)	2577	NP_389586.2	DNA mismatch repair recognition factor	Machinery gene

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
ymcA	spo0A	positive effect
spo0A	comK	negative effect
comK	comK	positive effect
comK	late competence genes	positive effect
codY	comK	negative effect
clpP	comK	negative effect
mecA	comK	negative effect
kre	comK	negative effect
abrB	comK	negative effect
comS	comK	positive effect
spo0A	comK	positive effect
rok	comK	negative effect
degU	comK	positive effect
clpC	comK	negative effect
med	comK	positive effect
comK	late competence genes	positive effect
clpP	degU	negative effect
abrB	rok	negative effect
spo0A	abrB	negative effect
comA	comS	positive effect
spo0A	rok	negative effect
ylbF	spo0A	positive effect
sinR	spo0A	negative effect
yaaT	spo0A	positive effect
sinR	rok	negative effect
sinR	degU	negative effect
degQ	degU	positive effect
clpC	degU	negative effect
degS	degU	positive effect
rapC	comA	negative effect
rapF	comA	negative effect
comP	comA	positive effect
sinI	sinR	negative effect
phrC	rapC	negative effect
phrF	rapF	negative effect
comX	comP	positive effect
comQ	comX	positive effect

Sequence

Protein

• Length: 143 a.a.
• Molecular weight: 16166.27 Da
• Isoelectric Point: 5.0437

>NTDB_id=666 BSU_17020 NP_389584.1 1774374..1774805(+) (ymcA) [Bacillus subtilis subsp. subtilis str. 168]
MTLYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDALQE
ELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITSTGGDLLKGETGSKVKHSNNSCSL

Nucleotide

• Length: 432 bp

>NTDB_id=666 BSU_17020 NP_389584.1 1774374..1774805(+) (ymcA) [Bacillus subtilis subsp. subtilis str. 168]
ATGACGCTCTACTCAAAAAAAGACATTGTGCAGCAGGCTCGAAACCTTGCAAAAATGATTTCTGAAACAGAAGAGGTTGA
TTTTTTCAAACGGGCTGAAGCGCAAATCAATGAGAATGACAAAGTGTCCACAATCGTTAATCAGATTAAAGCCCTGCAAA
AGCAGGCTGTCAATCTGAAGCATTATGAAAAGCATGAAGCGCTCAAACAAGTAGAAGCAAAAATTGACGCGCTGCAAGAA
GAGCTTGAAGAGATTCCTGTTATCCAGGAATTCAGAGACTCGCAAATGGAAGTAAATGACCTACTGCAGCTCGTTGCACA
CACCATTTCCAACCAAGTCACAAATGAAATCATCACATCAACCGGAGGCGACCTGCTGAAAGGGGAAACCGGTTCAAAGG
TGAAGCATTCAAATAACAGCTGTTCTCTCTAA

Domains

Predicted by InterProScan.

• Control of competence regulator ComK, YlbF/YmcA (Com_YlbF) (9-113)

References

• [1]: Eugenie Dubnau et al. (2023) Formation of a stable RNase Y-RicT (YaaT) complex requires RicA (YmcA) and RicF (YlbF). MBio 14(4):e0126923. [PMID: 37555678]
• [2]: Valerie J Carabetta et al. (2013) A complex of YlbF, YmcA and YaaT regulates sporulation, competence and biofilm formation by accelerating the phosphorylation of Spo0A. Molecular Microbiology 88(2):283-300. [PMID: 23490197]