Detailed information NTG1001625

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: ABFG87_RS02650
• Genome accession: NZ_CP156074
• Coordinates: 587666..587845 (-)
• Length: 59 a.a.
• NCBI ID: WP_136771876.1
• Uniprot ID: -
• Organism: Chitiniphilus eburneus strain YS-30
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 582666..592845

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABFG87_RS02635	-	583737..585218 (-)	1482	WP_136771879.1	hypothetical protein	-
ABFG87_RS02640	-	585215..585808 (-)	594	WP_136771878.1	hypothetical protein	-
ABFG87_RS02645	-	585817..587598 (-)	1782	WP_136771877.1	hypothetical protein	-
ABFG87_RS02650	pilA	587666..587845 (-)	180	WP_136771876.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
ABFG87_RS02655	-	587909..588814 (-)	906	WP_136771875.1	ABC transporter ATP-binding protein	-
ABFG87_RS02660	-	588825..589664 (-)	840	WP_136771874.1	hypothetical protein	-
ABFG87_RS02665	-	589661..590470 (-)	810	WP_136771873.1	hypothetical protein	-
ABFG87_RS02670	-	590538..590897 (-)	360	WP_136771872.1	hypothetical protein	-
ABFG87_RS02675	-	591020..591107 (-)	88	Protein_528	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
ABFG87_RS02685	-	591582..592340 (+)	759	WP_136771870.1	pseudouridine synthase	-

Sequence

Protein

• Length: 59 a.a.
• Molecular weight: 6510.61 Da
• Isoelectric Point: 9.8996

>NTDB_id=1001625 ABFG87_RS02650 WP_136771876.1 587666..587845(-) (pilA) [Chitiniphilus eburneus strain YS-30]
MRHMRGFTLIELMIVVAIIGILAAIAIPNYEQYMQKSSNKTAQADARNFLTAAVANSQN

Nucleotide

• Length: 180 bp

>NTDB_id=1001625 ABFG87_RS02650 WP_136771876.1 587666..587845(-) (pilA) [Chitiniphilus eburneus strain YS-30]
ATGAGACATATGCGGGGTTTTACGCTGATTGAACTGATGATAGTCGTAGCCATTATCGGAATCTTGGCGGCGATTGCAAT
TCCAAATTACGAACAATATATGCAAAAAAGCAGTAATAAAACAGCACAAGCCGACGCCAGGAATTTCCTGACAGCCGCCG
TGGCAAACTCTCAAAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Ralstonia pseudosolanacearum GMI1000	47.761	100	0.542
pilA	Vibrio parahaemolyticus RIMD 2210633	50	98.305	0.492
pilA	Pseudomonas aeruginosa PAK	65.909	74.576	0.492
pilA	Acinetobacter baumannii strain A118	75.676	62.712	0.475
pilA	Acinetobacter nosocomialis M2	75.676	62.712	0.475
pilA/pilAII	Pseudomonas stutzeri DSM 10701	64.286	71.186	0.458
pilA2	Legionella pneumophila strain ERS1305867	81.818	55.932	0.458
pilA2	Legionella pneumophila str. Paris	81.818	55.932	0.458
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	54.167	81.356	0.441
comF	Acinetobacter baylyi ADP1	78.788	55.932	0.441
pilE	Acinetobacter baumannii D1279779	60.465	72.881	0.441
comE	Acinetobacter baylyi ADP1	58.14	72.881	0.424
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	67.568	62.712	0.424
pilA	Vibrio cholerae strain A1552	67.568	62.712	0.424
pilA	Vibrio cholerae C6706	67.568	62.712	0.424
pilA	Vibrio campbellii strain DS40M4	67.568	62.712	0.424
pilA/pilAI	Pseudomonas stutzeri DSM 10701	75.758	55.932	0.424
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	72.727	55.932	0.407
pilA/pilA1	Eikenella corrodens VA1	69.697	55.932	0.39
pilE	Legionella pneumophila strain ERS1305867	50	77.966	0.39
pilE	Legionella pneumophila str. Paris	50	77.966	0.39
pilA	Haemophilus influenzae Rd KW20	67.647	57.627	0.39
pilA	Glaesserella parasuis strain SC1401	67.647	57.627	0.39
pilA	Haemophilus influenzae 86-028NP	67.647	57.627	0.39
pilA/pilA1	Synechocystis sp. PCC 6803	51.163	72.881	0.373