Detailed information NTG0081259

Bioinformatically predicted

Overview

• Name: fimU
• Type: Machinery gene
• Locus tag: MARGE09_RS21720
• Genome accession: NZ_AP023086
• Coordinates: 1740125..1740238 (-)
• Length: 37 a.a.
• NCBI ID: WP_420828088.1
• Uniprot ID: -
• Organism: Marinagarivorans cellulosilyticus strain GE09
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1735125..1745238

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MARGE09_RS06890 (MARGE09_P1328)	-	1737578..1738120 (-)	543	WP_236986604.1	pilus assembly PilX family protein	-
MARGE09_RS06895 (MARGE09_P1329)	-	1738113..1739147 (-)	1035	WP_236986605.1	PilW family protein	-
MARGE09_RS06900 (MARGE09_P1330)	pilV	1739148..1739717 (-)	570	WP_236986606.1	type IV pilus modification protein PilV	-
MARGE09_RS06905 (MARGE09_P1331)	-	1739708..1740109 (-)	402	WP_236986607.1	GspH/FimT family protein	-
MARGE09_RS21720	fimU	1740125..1740238 (-)	114	WP_420828088.1	type IV pilin protein	Machinery gene
MARGE09_RS06910 (MARGE09_P1333)	-	1740720..1741124 (-)	405	WP_275068744.1	type IV pilin protein	-

Sequence

Protein

• Length: 37 a.a.
• Molecular weight: 3935.71 Da
• Isoelectric Point: 5.8602

>NTDB_id=81259 MARGE09_RS21720 WP_420828088.1 1740125..1740238(-) (fimU) [Marinagarivorans cellulosilyticus strain GE09]
MGSKGFQYIAGFTLLELMVTISIMAIIAGVAVPSYQN

Nucleotide

• Length: 114 bp

>NTDB_id=81259 MARGE09_RS21720 WP_420828088.1 1740125..1740238(-) (fimU) [Marinagarivorans cellulosilyticus strain GE09]
ATGGGCAGTAAAGGCTTCCAATACATAGCAGGTTTTACCTTGCTGGAACTGATGGTCACGATATCTATCATGGCGATTAT
TGCCGGTGTCGCGGTGCCGTCTTACCAAAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
fimU	Acinetobacter baumannii D1279779	70.37	72.973	0.514
pilA	Haemophilus influenzae Rd KW20	66.667	72.973	0.486
pilA	Haemophilus influenzae 86-028NP	66.667	72.973	0.486
pilY2	Acinetobacter baumannii D1279779	56.25	86.486	0.486
fimT	Legionella pneumophila strain Lp02	65.385	70.27	0.459
comE	Acinetobacter baylyi ADP1	65.385	70.27	0.459
pilE	Neisseria gonorrhoeae strain FA1090	59.259	72.973	0.432
pilE	Neisseria gonorrhoeae MS11	59.259	72.973	0.432
comF	Acinetobacter baylyi ADP1	59.259	72.973	0.432
pilA	Pseudomonas aeruginosa PAK	55.556	72.973	0.405
pilA	Acinetobacter baumannii strain A118	55.556	72.973	0.405
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	55.556	72.973	0.405
pilA/pilA1	Eikenella corrodens VA1	55.556	72.973	0.405
pilA	Acinetobacter nosocomialis M2	55.556	72.973	0.405
pilA/pilAI	Pseudomonas stutzeri DSM 10701	48.387	83.784	0.405
pilA/pilAII	Pseudomonas stutzeri DSM 10701	51.852	72.973	0.378
pilA2	Legionella pneumophila strain ERS1305867	51.852	72.973	0.378
pilA2	Legionella pneumophila str. Paris	51.852	72.973	0.378
pilL	Neisseria gonorrhoeae MS11	51.852	72.973	0.378
pilA	Vibrio campbellii strain DS40M4	51.852	72.973	0.378
pilA	Ralstonia pseudosolanacearum GMI1000	51.852	72.973	0.378
pilA	Vibrio parahaemolyticus RIMD 2210633	51.852	72.973	0.378
pilX	Neisseria meningitidis 8013	53.846	70.27	0.378