Detailed information
Bioinformatically predicted
Overview
| Name | comEA | Type | Machinery gene |
| Locus tag | P3T93_RS06170 | Genome accession | NZ_CP119997 |
| Coordinates | 1241809..1241955 (+) | Length | 48 a.a. |
| NCBI ID | WP_230620687.1 | Uniprot ID | - |
| Organism | Staphylococcus cohnii strain Dog166 | ||
| Function | dsDNA binding to the cell surface (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1236809..1246955
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3T93_RS06135 (P3T93_06135) | aroE | 1237862..1238659 (+) | 798 | WP_019469396.1 | shikimate dehydrogenase | - |
| P3T93_RS06140 (P3T93_06140) | yhbY | 1238672..1238962 (+) | 291 | WP_019469395.1 | ribosome assembly RNA-binding protein YhbY | - |
| P3T93_RS06145 (P3T93_06145) | nadD | 1238962..1239534 (+) | 573 | WP_026034801.1 | nicotinate (nicotinamide) nucleotide adenylyltransferase | - |
| P3T93_RS06150 (P3T93_06150) | yqeK | 1239524..1240108 (+) | 585 | WP_040030028.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
| P3T93_RS06155 (P3T93_06155) | rsfS | 1240109..1240462 (+) | 354 | WP_019469392.1 | ribosome silencing factor | - |
| P3T93_RS06160 (P3T93_06160) | - | 1240465..1241190 (+) | 726 | WP_019469391.1 | class I SAM-dependent methyltransferase | - |
| P3T93_RS06165 (P3T93_06165) | - | 1241240..1241773 (+) | 534 | WP_051000495.1 | hypothetical protein | - |
| P3T93_RS06170 (P3T93_06170) | comEA | 1241809..1241955 (+) | 147 | WP_230620687.1 | helix-hairpin-helix domain-containing protein | Machinery gene |
| P3T93_RS06175 (P3T93_06175) | - | 1242037..1242498 (+) | 462 | WP_019469390.1 | ComE operon protein 2 | - |
| P3T93_RS06180 (P3T93_06180) | - | 1242594..1243502 (+) | 909 | WP_080760401.1 | ComEC/Rec2 family competence protein | - |
| P3T93_RS06185 (P3T93_06185) | - | 1243597..1243797 (+) | 201 | Protein_1181 | ComEC/Rec2 family competence protein | - |
| P3T93_RS06190 (P3T93_06190) | - | 1243882..1244727 (+) | 846 | WP_019469388.1 | ComEC/Rec2 family competence protein | - |
| P3T93_RS06195 (P3T93_06195) | holA | 1244803..1245777 (+) | 975 | WP_019469387.1 | DNA polymerase III subunit delta | - |
| P3T93_RS06200 (P3T93_06200) | rpsT | 1246009..1246260 (-) | 252 | WP_019469386.1 | 30S ribosomal protein S20 | - |
Sequence
Protein
Download Length: 48 a.a. Molecular weight: 5377.24 Da Isoelectric Point: 10.2107
>NTDB_id=801430 P3T93_RS06170 WP_230620687.1 1241809..1241955(+) (comEA) [Staphylococcus cohnii strain Dog166]
MPGIGKVKTKAIIEYREQNGNFKSIDQLKEINGFGTKTIEKLSSHLTI
MPGIGKVKTKAIIEYREQNGNFKSIDQLKEINGFGTKTIEKLSSHLTI
Nucleotide
Download Length: 147 bp
>NTDB_id=801430 P3T93_RS06170 WP_230620687.1 1241809..1241955(+) (comEA) [Staphylococcus cohnii strain Dog166]
ATGCCTGGAATAGGAAAGGTTAAAACTAAAGCTATCATTGAATATCGTGAGCAAAACGGTAATTTTAAATCTATTGATCA
ATTGAAAGAAATTAATGGATTCGGTACTAAAACAATAGAAAAATTAAGTTCACATTTAACAATCTAA
ATGCCTGGAATAGGAAAGGTTAAAACTAAAGCTATCATTGAATATCGTGAGCAAAACGGTAATTTTAAATCTATTGATCA
ATTGAAAGAAATTAATGGATTCGGTACTAAAACAATAGAAAAATTAAGTTCACATTTAACAATCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.