Detailed information NTG0787626

Bioinformatically predicted

Overview

• Name: pilA/pilA1
• Type: Machinery gene
• Locus tag: PQO03_RS15935
• Genome accession: NZ_CP117812
• Coordinates: 1119013..1119123 (-)
• Length: 36 a.a.
• NCBI ID: WP_274154185.1
• Uniprot ID: -
• Organism: Lentisphaera profundi strain SAORIC-696
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1114013..1124123

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PQO03_RS15920 (PQO03_15920)	-	1114985..1115896 (-)	912	WP_274154182.1	hypothetical protein	-
PQO03_RS15925 (PQO03_15925)	-	1115900..1117435 (-)	1536	WP_274154183.1	sialate O-acetylesterase	-
PQO03_RS15930 (PQO03_15930)	-	1117432..1118982 (-)	1551	WP_274154184.1	GDSL-type esterase/lipase family protein	-
PQO03_RS15935 (PQO03_15935)	pilA/pilA1	1119013..1119123 (-)	111	WP_274154185.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
PQO03_RS15940 (PQO03_15940)	-	1119341..1120408 (-)	1068	WP_274154186.1	Fic family protein	-
PQO03_RS15945 (PQO03_15945)	-	1120523..1120762 (-)	240	WP_274154187.1	sulfatase-like hydrolase/transferase	-
PQO03_RS15950 (PQO03_15950)	-	1121028..1122032 (+)	1005	WP_274154188.1	3-keto-disaccharide hydrolase	-

Sequence

Protein

• Length: 36 a.a.
• Molecular weight: 3908.91 Da
• Isoelectric Point: 10.7840

>NTDB_id=787626 PQO03_RS15935 WP_274154185.1 1119013..1119123(-) (pilA/pilA1) [Lentisphaera profundi strain SAORIC-696]
MSQTSKKLRLFTLIELLVVIAIIGILASLLLPSLSL

Nucleotide

• Length: 111 bp

>NTDB_id=787626 PQO03_RS15935 WP_274154185.1 1119013..1119123(-) (pilA/pilA1) [Lentisphaera profundi strain SAORIC-696]
ATGTCACAAACTTCAAAAAAACTTCGTCTATTCACCCTCATTGAATTACTTGTGGTCATTGCCATTATTGGCATCCTAGC
TTCATTGCTCCTCCCCAGCTTATCATTATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA/pilA1	Synechocystis sp. PCC 6803	61.111	100	0.611
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	79.167	66.667	0.528
pilA	Vibrio campbellii strain DS40M4	56.25	88.889	0.5
comYC	Streptococcus gordonii str. Challis substr. CH1	53.125	88.889	0.472
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	84.211	52.778	0.444
pilA	Vibrio parahaemolyticus RIMD 2210633	57.143	77.778	0.444
comF	Acinetobacter baylyi ADP1	69.565	63.889	0.444
pilE	Neisseria gonorrhoeae strain FA1090	69.565	63.889	0.444
pilE	Neisseria gonorrhoeae MS11	69.565	63.889	0.444
pilH	Neisseria gonorrhoeae MS11	48.387	86.111	0.417
comYC	Streptococcus suis isolate S10	51.724	80.556	0.417
pilY2	Acinetobacter baumannii D1279779	65.217	63.889	0.417
fimT	Acinetobacter baylyi ADP1	65.217	63.889	0.417
pilA	Ralstonia pseudosolanacearum GMI1000	60.87	63.889	0.389
pilW	Acinetobacter baumannii D1279779	46.667	83.333	0.389
comGC/cglC	Streptococcus pneumoniae D39	48.276	80.556	0.389
ctsG	Campylobacter jejuni subsp. jejuni 81-176	51.852	75	0.389
comGC/cglC	Streptococcus pneumoniae Rx1	48.276	80.556	0.389
comGC/cglC	Streptococcus pneumoniae R6	48.276	80.556	0.389
comGC/cglC	Streptococcus pneumoniae TIGR4	48.276	80.556	0.389
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	50	77.778	0.389
pilA	Vibrio cholerae strain A1552	50	77.778	0.389
pilA	Vibrio cholerae C6706	50	77.778	0.389
pilE	Legionella pneumophila strain ERS1305867	42.424	91.667	0.389
pilE	Legionella pneumophila str. Paris	42.424	91.667	0.389
fimU	Acinetobacter baumannii D1279779	52	69.444	0.361
comGF	Lactococcus lactis subsp. cremoris KW2	48.148	75	0.361
comGD	Staphylococcus aureus N315	41.935	86.111	0.361
comGD	Staphylococcus aureus MW2	41.935	86.111	0.361