Detailed information NTG0072645

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: PKHYL_RS17030
• Genome accession: NZ_AP019516
• Coordinates: 361190..361384 (+)
• Length: 64 a.a.
• NCBI ID: WP_269778219.1
• Uniprot ID: A0A7U6QMB6
• Organism: Psychrobacter sp. KH172YL61
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 356190..366384

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PKHYL_RS01865 (PKHYL_04320)	-	356403..359276 (+)	2874	WP_240365848.1	pilus assembly protein PilY	-
PKHYL_RS01870 (PKHYL_04330)	-	359289..359840 (+)	552	WP_240365849.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
PKHYL_RS01875 (PKHYL_04340)	-	359840..360283 (+)	444	WP_240365850.1	type IV pilin protein	-
PKHYL_RS17935 (PKHYL_04350)	pilA/pilA1	360647..361099 (+)	453	WP_332835917.1	pilin	Machinery gene
PKHYL_RS17030 (PKHYL_04360)	pilA	361190..361384 (+)	195	WP_269778219.1	pilin	Machinery gene
PKHYL_RS01895 (PKHYL_04370)	-	361356..361640 (+)	285	WP_240365851.1	pilin	-
PKHYL_RS01900 (PKHYL_04380)	tfpZ	361800..362456 (+)	657	WP_240365852.1	TfpX/TfpZ family type IV pilin accessory protein	-
PKHYL_RS01905 (PKHYL_04390)	fdxA	362542..362865 (-)	324	WP_011279554.1	ferredoxin FdxA	-
PKHYL_RS01910 (PKHYL_04400)	mutS	362963..366048 (-)	3086	Protein_376	DNA mismatch repair protein MutS	-

Sequence

Protein

• Length: 64 a.a.
• Molecular weight: 7096.34 Da
• Isoelectric Point: 8.6216

>NTDB_id=72645 PKHYL_RS17030 WP_269778219.1 361190..361384(+) (pilA) [Psychrobacter sp. KH172YL61]
MRIQNGFTLIELMIVTAMIGILAAIAIPSYLNYIGKSQTVEGFTVSNGLRSEIAAHVWENKRFP

Nucleotide

• Length: 195 bp

>NTDB_id=72645 PKHYL_RS17030 WP_269778219.1 361190..361384(+) (pilA) [Psychrobacter sp. KH172YL61]
ATGAGAATACAGAACGGTTTCACTTTAATAGAGCTGATGATTGTCACCGCTATGATCGGTATTCTAGCAGCTATCGCCAT
ACCCAGTTATTTAAATTATATTGGTAAATCTCAAACAGTCGAAGGTTTTACTGTCTCTAATGGTTTGCGTAGTGAGATAG
CGGCACATGTATGGGAAAACAAACGCTTTCCCTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

3D structure

• AlphaFold DB: A0A7U6QMB6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Acinetobacter nosocomialis M2	58.73	98.438	0.578
pilA/pilA1	Eikenella corrodens VA1	50.794	98.438	0.5
pilA	Acinetobacter baumannii strain A118	72.727	68.75	0.5
pilA2	Legionella pneumophila strain ERS1305867	48.438	100	0.484
pilA2	Legionella pneumophila str. Paris	48.438	100	0.484
pilA	Ralstonia pseudosolanacearum GMI1000	50	96.875	0.484
pilA	Vibrio cholerae strain A1552	49.206	98.438	0.484
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	49.206	98.438	0.484
pilA	Vibrio cholerae C6706	49.206	98.438	0.484
pilA	Vibrio campbellii strain DS40M4	51.724	90.625	0.469
pilA	Vibrio parahaemolyticus RIMD 2210633	49.153	92.188	0.453
pilA	Pseudomonas aeruginosa PAK	54.717	82.813	0.453
comP	Acinetobacter baylyi ADP1	49.123	89.063	0.438
pilA	Haemophilus influenzae 86-028NP	48.214	87.5	0.422
pilA	Haemophilus influenzae Rd KW20	47.368	89.063	0.422
comF	Acinetobacter baylyi ADP1	78.788	51.563	0.406
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	50	81.25	0.406
pilE	Neisseria gonorrhoeae MS11	41.935	96.875	0.406
pilL	Neisseria gonorrhoeae MS11	43.86	89.063	0.391
pilE	Neisseria gonorrhoeae strain FA1090	49.02	79.688	0.391
pilA	Glaesserella parasuis strain SC1401	44.643	87.5	0.391
pilA/pilAI	Pseudomonas stutzeri DSM 10701	66.667	56.25	0.375
pilE	Acinetobacter baumannii D1279779	70.588	53.125	0.375