Detailed information NTG0396430

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: GH742_RS04850
• Genome accession: NZ_CP045732
• Coordinates: 1023475..1023885 (+)
• Length: 136 a.a.
• NCBI ID: WP_203456338.1
• Uniprot ID: -
• Organism: Legionella sp. MW5194
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1018475..1028885

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GH742_RS04825 (GH742_04805)	-	1019747..1021153 (-)	1407	WP_203456334.1	amino acid permease	-
GH742_RS04830 (GH742_04810)	-	1021317..1021724 (+)	408	WP_203456335.1	hypothetical protein	-
GH742_RS04835 (GH742_04815)	-	1021726..1022169 (-)	444	WP_203456336.1	secondary thiamine-phosphate synthase enzyme YjbQ	-
GH742_RS04840 (GH742_04820)	-	1022162..1022479 (-)	318	WP_203456337.1	BolA family transcriptional regulator	-
GH742_RS04845 (GH742_04825)	pilA2	1022800..1023210 (+)	411	WP_058525546.1	pilin	Machinery gene
GH742_RS04850 (GH742_04830)	pilA2	1023475..1023885 (+)	411	WP_203456338.1	pilin	Machinery gene
GH742_RS04855 (GH742_04835)	pilA2	1023997..1024407 (+)	411	WP_203456339.1	pilin	Machinery gene
GH742_RS04860 (GH742_04840)	-	1024436..1025671 (-)	1236	WP_203456340.1	6-phosphofructokinase	-
GH742_RS04865 (GH742_04845)	letS	1025695..1028445 (-)	2751	WP_203456341.1	two-component system sensor histidine kinase LetS	Regulator

Sequence

Protein

• Length: 136 a.a.
• Molecular weight: 13822.12 Da
• Isoelectric Point: 9.0520

>NTDB_id=396430 GH742_RS04850 WP_203456338.1 1023475..1023885(+) (pilA2) [Legionella sp. MW5194]
MRQKGFTLIELMIVVAIVGILAAIAIPAYQDYTIRARVTEGLNLAASAKLAVSETAITNNALPATQAATGYVSPAATPNV
TSIVIGAGGVITITYTAAAGGGTIIMTPTLQANGDVTWVCTGGTLLAKYRPASCRP

Nucleotide

• Length: 411 bp

>NTDB_id=396430 GH742_RS04850 WP_203456338.1 1023475..1023885(+) (pilA2) [Legionella sp. MW5194]
ATGAGACAGAAGGGTTTTACGCTGATTGAATTAATGATTGTTGTCGCCATTGTCGGCATTCTGGCTGCAATCGCTATTCC
AGCTTATCAGGATTACACCATTAGAGCGCGGGTGACGGAAGGCTTAAACCTGGCGGCGTCGGCCAAACTGGCTGTTTCTG
AAACAGCCATTACCAATAACGCCTTACCCGCTACCCAGGCAGCAACGGGTTATGTTAGCCCGGCAGCTACGCCCAATGTC
ACCTCGATTGTGATTGGGGCAGGTGGTGTCATCACCATTACCTACACAGCAGCAGCCGGTGGCGGTACGATTATCATGAC
GCCAACATTGCAGGCCAACGGCGATGTCACCTGGGTGTGTACCGGAGGTACATTGTTAGCGAAATACCGTCCAGCCAGTT
GCAGACCTTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (35-135)

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila strain ERS1305867	94.853	100	0.949
pilA2	Legionella pneumophila str. Paris	94.118	100	0.941
pilA	Ralstonia pseudosolanacearum GMI1000	50.932	100	0.603
comP	Acinetobacter baylyi ADP1	51.034	100	0.544
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	35.87	100	0.485
pilE	Neisseria gonorrhoeae strain FA1090	38.462	100	0.441
pilE	Neisseria gonorrhoeae MS11	38.217	100	0.441
pilA/pilA1	Eikenella corrodens VA1	39.865	100	0.434
pilA	Haemophilus influenzae 86-028NP	40.136	100	0.434
pilA/pilAI	Pseudomonas stutzeri DSM 10701	42.222	99.265	0.419
pilA	Pseudomonas aeruginosa PAK	35.897	100	0.412
pilA	Haemophilus influenzae Rd KW20	39.568	100	0.404
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.13	100	0.397
pilA	Vibrio cholerae C6706	37.063	100	0.39
pilA	Vibrio cholerae strain A1552	37.063	100	0.39
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.063	100	0.39
pilA	Acinetobacter baumannii strain A118	37.956	100	0.382
pilA	Glaesserella parasuis strain SC1401	38.235	100	0.382
pilA	Vibrio parahaemolyticus RIMD 2210633	39.231	95.588	0.375