Detailed information NTG0385314

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: F0Q17_RS22200
• Genome accession: NZ_CP043579
• Coordinates: 4130437..4130529 (+)
• Length: 30 a.a.
• NCBI ID: WP_182310263.1
• Uniprot ID: -
• Organism: Aeromonas media strain R1-26
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	4130599..4131873	4130437..4130529	flank	70

Gene organization within MGE regions

Location: 4130437..4131873

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
F0Q17_RS22200	pilA	4130437..4130529 (+)	93	WP_182310263.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
F0Q17_RS19140	-	4130599..4131873 (+)	1275	WP_011191341.1	IS4-like element ISApu2 family transposase	-

Sequence

Protein

• Length: 30 a.a.
• Molecular weight: 3183.83 Da
• Isoelectric Point: 7.9982

>NTDB_id=385314 F0Q17_RS22200 WP_182310263.1 4130437..4130529(+) (pilA) [Aeromonas media strain R1-26]
MKRQSGFTLIELMIVVAIIATCTGSLATTN

Nucleotide

• Length: 93 bp

>NTDB_id=385314 F0Q17_RS22200 WP_182310263.1 4130437..4130529(+) (pilA) [Aeromonas media strain R1-26]
ATGAAAAGACAGTCGGGTTTTACCCTGATCGAACTGATGATAGTGGTAGCTATCATCGCCACATGTACAGGATCTTTAGC
TACAACCAATTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-25)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Vibrio parahaemolyticus RIMD 2210633	84.211	63.333	0.533
pilA	Ralstonia pseudosolanacearum GMI1000	84.211	63.333	0.533
pilA	Vibrio campbellii strain DS40M4	84.211	63.333	0.533
pilA	Vibrio cholerae C6706	78.947	63.333	0.5
pilA	Vibrio cholerae strain A1552	78.947	63.333	0.5
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	78.947	63.333	0.5
pilA	Pseudomonas aeruginosa PAK	87.5	53.333	0.467
pilL	Neisseria gonorrhoeae MS11	76.471	56.667	0.433
pilE	Neisseria gonorrhoeae MS11	76.471	56.667	0.433
pilE	Neisseria gonorrhoeae strain FA1090	76.471	56.667	0.433
pilX	Neisseria meningitidis 8013	76.471	56.667	0.433
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	56.522	76.667	0.433
comYD	Streptococcus mutans UA159	39.394	100	0.433
comYD	Streptococcus mutans UA140	39.394	100	0.433
pilA	Acinetobacter nosocomialis M2	81.25	53.333	0.433
pilA	Acinetobacter baumannii strain A118	81.25	53.333	0.433
pilA2	Legionella pneumophila strain ERS1305867	92.857	46.667	0.433
pilA2	Legionella pneumophila str. Paris	92.857	46.667	0.433
pilA/pilAI	Pseudomonas stutzeri DSM 10701	92.308	43.333	0.4
comF	Acinetobacter baylyi ADP1	75	53.333	0.4
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	85.714	46.667	0.4
comGF	Latilactobacillus sakei subsp. sakei 23K	40.741	90	0.367
pilA/pilA1	Synechocystis sp. PCC 6803	57.895	63.333	0.367
pilY2	Acinetobacter baumannii D1279779	55	66.667	0.367
xcpW	Acinetobacter baumannii D1279779	47.826	76.667	0.367
fimT	Acinetobacter baylyi ADP1	73.333	50	0.367