Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | ES276_RS04640 | Genome accession | NZ_CP038252 |
| Coordinates | 891950..892099 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain TVO_1901936 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 886950..897099
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ES276_RS10930 (ES276_04940) | comA/nlmT | 886993..887580 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| ES276_RS04595 (ES276_04945) | blpI | 887860..888057 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| ES276_RS04600 (ES276_04955) | blpJ | 888524..888793 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| ES276_RS04605 (ES276_04960) | blpU | 888862..889092 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| ES276_RS04610 (ES276_04965) | - | 889095..889214 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| ES276_RS04615 (ES276_04970) | - | 889511..889675 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| ES276_RS04620 (ES276_04975) | - | 889672..890076 (+) | 405 | WP_000846943.1 | hypothetical protein | - |
| ES276_RS04625 (ES276_04980) | - | 890279..891083 (+) | 805 | WP_100214365.1 | IS5 family transposase | - |
| ES276_RS04630 (ES276_04985) | blpM | 891233..891487 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| ES276_RS04635 (ES276_04990) | blpN | 891503..891706 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| ES276_RS04640 (ES276_05000) | cipB | 891950..892099 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| ES276_RS04645 (ES276_05005) | - | 892203..892322 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| ES276_RS04650 (ES276_05010) | - | 893107..893490 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| ES276_RS04655 (ES276_05015) | - | 893542..894231 (+) | 690 | WP_000760538.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ES276_RS04660 (ES276_05020) | blpZ | 894273..894506 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| ES276_RS04665 (ES276_05030) | - | 894657..895268 (+) | 612 | WP_000394045.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ES276_RS04670 (ES276_05035) | ccrZ | 895429..896223 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| ES276_RS04675 (ES276_05040) | trmB | 896220..896855 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=310225 ES276_RS04640 WP_001818346.1 891950..892099(+) (cipB) [Streptococcus pneumoniae strain TVO_1901936]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=310225 ES276_RS04640 WP_001818346.1 891950..892099(+) (cipB) [Streptococcus pneumoniae strain TVO_1901936]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |