Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE/blpR   Type   Regulator
Locus tag   CCX85_RS09280 Genome accession   NZ_CP021640
Coordinates   380254..380472 (+) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain JS12     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context


Location: 375254..385472
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CCX85_RS02015 (CCX85_02020) - 376261..376836 (+) 576 WP_101248307.1 uracil-DNA glycosylase family protein -
  CCX85_RS02020 (CCX85_02025) ybeY 376995..377492 (+) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  CCX85_RS02025 (CCX85_02030) - 377473..377880 (+) 408 WP_002985746.1 diacylglycerol kinase family protein -
  CCX85_RS02030 (CCX85_02035) era 378000..378896 (+) 897 WP_002985743.1 GTPase Era -
  CCX85_RS02035 (CCX85_02040) - 378917..379393 (+) 477 WP_002993018.1 NUDIX hydrolase -
  CCX85_RS09275 (CCX85_02045) - 379699..379953 (-) 255 WP_014407373.1 hypothetical protein -
  CCX85_RS09280 comE/blpR 380254..380472 (+) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  CCX85_RS09285 (CCX85_02060) - 380669..382275 (-) 1607 Protein_348 ABC transporter transmembrane domain-containing protein -
  CCX85_RS02065 (CCX85_02065) - 382573..382797 (+) 225 WP_002994580.1 Blp family class II bacteriocin -
  CCX85_RS09185 - 382775..382951 (+) 177 WP_002994581.1 hypothetical protein -
  CCX85_RS09520 (CCX85_02070) - 383246..383557 (+) 312 WP_225793061.1 CPBP family intramembrane glutamic endopeptidase -
  CCX85_RS09405 - 383642..383770 (+) 129 WP_002994583.1 hypothetical protein -
  CCX85_RS02075 (CCX85_02075) - 384168..384395 (+) 228 WP_028797129.1 Blp family class II bacteriocin -
  CCX85_RS02080 (CCX85_02080) - 384444..384761 (+) 318 WP_002994587.1 hypothetical protein -

Sequence


Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=194493 CCX85_RS09280 WP_072135532.1 380254..380472(+) (comE/blpR) [Streptococcus pyogenes strain JS12]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=194493 CCX85_RS09280 WP_072135532.1 380254..380472(+) (comE/blpR) [Streptococcus pyogenes strain JS12]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains


Predicted by InterProScan.

(3-55)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417


Multiple sequence alignment