NTDB

Overview

Name	recA	Type	Machinery gene
Locus tag	PYW37_RS06350	Genome accession	NZ_CP118969
Coordinates	1256113..1256316 (-)	Length	67 a.a.
NCBI ID	WP_250645389.1	Uniprot ID	-
Organism	Lactococcus lactis strain DSM 20481
Function	homologous recombination (predicted from homology) Homologous recombination

Genomic Context

Location: 1251113..1261316

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYW37_RS06315	-	1251407..1252330 (-)	924	WP_023189236.1	FAD:protein FMN transferase	-
PYW37_RS06320	-	1252510..1253562 (-)	1053	WP_023189235.1	BMP family protein	-
PYW37_RS06325	-	1253627..1254106 (-)	480	WP_023189234.1	nucleoside 2-deoxyribosyltransferase	-
PYW37_RS06330	-	1254090..1254644 (-)	555	WP_025017081.1	TIGR00730 family Rossman fold protein	-
PYW37_RS06335	-	1254647..1255297 (-)	651	WP_023189232.1	deoxynucleoside kinase	-
PYW37_RS06340	-	1255778..1255999 (-)	222	WP_306305599.1	hypothetical protein	-
PYW37_RS06350	recA	1256113..1256316 (-)	204	WP_250645389.1	DNA recombination/repair protein RecA	Machinery gene
PYW37_RS06360	-	1256616..1257353 (-)	738	WP_004257908.1	MIP/aquaporin family protein	-
PYW37_RS06365	glpO	1257405..1259234 (-)	1830	WP_044009675.1	type 1 glycerol-3-phosphate oxidase	-
PYW37_RS06370	glpK	1259271..1260767 (-)	1497	Protein_1245	glycerol kinase GlpK	-

Sequence

Protein

Download Length: 67 a.a. Molecular weight: 7258.40 Da Isoelectric Point: 3.9716

                                >NTDB_id=796959 PYW37_RS06350 WP_250645389.1 1256113..1256316(-) (recA) [Lactococcus lactis strain DSM 20481]

MIFVQPDTGEEAFNMINEFIKTGAFDLIVVDSVAALTPTLEIDGVSIPGQQAKMMSEQLSKLVSKVN

Nucleotide

Download Length: 204 bp

                                >NTDB_id=796959 PYW37_RS06350 WP_250645389.1 1256113..1256316(-) (recA) [Lactococcus lactis strain DSM 20481]

TTGATATTCGTTCAACCAGATACAGGCGAAGAGGCCTTCAATATGATTAACGAGTTTATCAAAACAGGGGCCTTTGATTT

AATTGTTGTCGATTCGGTTGCTGCTCTGACACCTACTTTAGAGATAGATGGAGTGAGTATTCCAGGTCAGCAAGCTAAAA

TGATGTCAGAACAGCTCTCTAAGCTCGTTTCAAAAGTCAACTAA

Domains

Predicted by InterproScan.

recA bacterial DNA recombination protein (RecA)

(2-66)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
recA	Streptococcus pneumoniae TIGR4	47.143	100	0.493
recA	Streptococcus pyogenes NZ131	47.143	100	0.493
recA	Streptococcus mutans UA159	47.143	100	0.493
recA	Riemerella anatipestifer ATCC 11845 = DSM 15868	47.143	100	0.493
recA	Streptococcus mitis SK321	47.143	100	0.493
recA	Streptococcus mitis NCTC 12261	47.143	100	0.493
recA	Streptococcus pneumoniae Rx1	47.143	100	0.493
recA	Streptococcus pneumoniae D39	47.143	100	0.493
recA	Streptococcus pneumoniae R6	47.143	100	0.493
recA	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	50	98.507	0.493
recA	Vibrio cholerae O1 biovar El Tor strain E7946	46.377	100	0.478
recA	Vibrio cholerae strain A1552	46.377	100	0.478
recA	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	47.761	100	0.478
recA	Acinetobacter baumannii D1279779	47.761	100	0.478
recA	Acinetobacter baylyi ADP1	47.761	100	0.478
recA	Lactococcus lactis subsp. cremoris KW2	45.714	100	0.478
recA	Bacillus subtilis subsp. subtilis str. 168	45.714	100	0.478
recA	Glaesserella parasuis strain SC1401	44.928	100	0.463
recA	Helicobacter pylori strain NCTC11637	46.269	100	0.463
recA	Helicobacter pylori 26695	46.269	100	0.463
recA	Ralstonia pseudosolanacearum GMI1000	44.286	100	0.463
recA	Latilactobacillus sakei subsp. sakei 23K	42.857	100	0.448
recA	Neisseria gonorrhoeae MS11	43.478	100	0.448
recA	Neisseria gonorrhoeae MS11	43.478	100	0.448
recA	Neisseria gonorrhoeae strain FA1090	43.478	100	0.448
recA	Pseudomonas stutzeri DSM 10701	40.58	100	0.418

Detailed information NTG0796959