NTDB

Overview

Name	pilB	Type	Machinery gene
Locus tag	PL321_RS19980	Genome accession	NZ_CP117677
Coordinates	1476426..1477004 (+)	Length	192 a.a.
NCBI ID	WP_337960801.1	Uniprot ID	-
Organism	Caloramator sp. mosi_1
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1471426..1482004

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PL321_RS10455 (PL321_10470)	-	1471590..1471784 (+)	195	WP_273961977.1	hypothetical protein	-
PL321_RS10460 (PL321_10475)	-	1471849..1472546 (+)	698	Protein_2055	response regulator transcription factor	-
PL321_RS10465 (PL321_10480)	-	1472854..1473825 (+)	972	WP_273961978.1	HAMP domain-containing sensor histidine kinase	-
PL321_RS10475 (PL321_10490)	-	1473925..1474440 (+)	516	WP_273961979.1	hypothetical protein	-
PL321_RS10480 (PL321_10495)	-	1474807..1475034 (+)	228	WP_273961980.1	hypothetical protein	-
PL321_RS10485 (PL321_10500)	-	1475034..1475324 (+)	291	WP_273961981.1	hypothetical protein	-
PL321_RS19970	-	1475676..1476061 (+)	386	Protein_2060	hypothetical protein	-
PL321_RS19975	-	1476076..1476414 (+)	339	WP_337961152.1	ATPase, T2SS/T4P/T4SS family	-
PL321_RS19980	pilB	1476426..1477004 (+)	579	WP_337960801.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
PL321_RS10495 (PL321_10510)	-	1477329..1478222 (+)	894	WP_273961982.1	type II secretion system F family protein	-
PL321_RS10500 (PL321_10515)	pilC	1478215..1478424 (+)	210	WP_273961983.1	type II secretion system F family protein	Machinery gene
PL321_RS10505 (PL321_10520)	-	1478471..1478584 (+)	114	Protein_2065	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
PL321_RS10510 (PL321_10525)	-	1478919..1479425 (+)	507	WP_273961984.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
PL321_RS10515 (PL321_10530)	-	1479631..1479981 (+)	351	WP_273961985.1	hypothetical protein	-
PL321_RS10520 (PL321_10535)	pilM	1479993..1480913 (+)	921	WP_273961986.1	pilus assembly protein PilM	-
PL321_RS10525 (PL321_10540)	-	1480929..1481483 (+)	555	WP_273961987.1	PilN domain-containing protein	-

Sequence

Protein

Download Length: 192 a.a. Molecular weight: 21309.39 Da Isoelectric Point: 5.3193

                                >NTDB_id=786908 PL321_RS19980 WP_337960801.1 1476426..1477004(+) (pilB) [Caloramator sp. mosi_1]

MQYEKLVSSPHGIILVSGPTGSGKSTTLYTALRELNTGDRNIITVEDPVESTIYGVNQVEVNPKAGLTFASALRSILRQD

PDIIMIGEIRDRETAEIAVRAAITGHLVLSTIHTNDAPSSVTRLIDMGVESFMISSSLIGVIAQRLVRRICPHCKMEYFA

NLDEIKALGLDENKEYKLYREQDVYTVDKRDI

Nucleotide

Download Length: 579 bp

                                >NTDB_id=786908 PL321_RS19980 WP_337960801.1 1476426..1477004(+) (pilB) [Caloramator sp. mosi_1]

ATGCAGTATGAAAAACTTGTATCTTCACCCCACGGAATAATATTGGTTTCGGGACCCACAGGAAGTGGTAAGTCAACAAC

CCTTTACACCGCCCTTAGGGAGCTAAATACAGGGGATAGAAATATAATAACAGTTGAAGATCCTGTTGAAAGTACAATAT

ATGGTGTAAATCAGGTCGAAGTAAATCCTAAGGCAGGACTTACCTTTGCATCAGCCCTAAGGTCAATTTTAAGACAGGAC

CCAGATATCATAATGATAGGCGAGATAAGAGATAGAGAAACAGCAGAGATAGCAGTAAGAGCGGCTATAACAGGCCACTT

GGTTTTATCTACAATACACACCAATGATGCACCAAGTTCTGTAACAAGGCTTATAGATATGGGTGTTGAAAGCTTTATGA

TAAGTTCCTCTTTAATCGGCGTTATAGCCCAAAGACTTGTTAGAAGAATATGTCCCCACTGCAAAATGGAATATTTTGCA

AACCTTGACGAAATAAAGGCACTTGGGCTTGATGAGAATAAGGAATACAAGCTTTATAGGGAGCAGGATGTATATACTGT

GGACAAAAGGGATATATAG

Domains

Predicted by InterproScan.

Type II/IV secretion system protein (T2SSE)

(2-149)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilB	Legionella pneumophila strain ERS1305867	58.242	94.792	0.552
pilF	Thermus thermophilus HB27	59.064	89.063	0.526
pilF	Neisseria gonorrhoeae MS11	55.056	92.708	0.51
pilB	Acinetobacter baylyi ADP1	63.399	79.688	0.505
pilB	Vibrio cholerae strain A1552	62.987	80.208	0.505
pilB	Acinetobacter baumannii D1279779	61.688	80.208	0.495
pilB	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	53.801	89.063	0.479
pilB	Vibrio campbellii strain DS40M4	59.477	79.688	0.474
pilB	Vibrio parahaemolyticus RIMD 2210633	59.477	79.688	0.474
pilB	Haemophilus influenzae 86-028NP	59.868	79.167	0.474
pilB	Haemophilus influenzae Rd KW20	58.553	79.167	0.464
ctsE	Campylobacter jejuni subsp. jejuni 81-176	58.553	79.167	0.464
pilB/pilB1	Synechocystis sp. PCC 6803	52.41	86.458	0.453
pilB	Glaesserella parasuis strain SC1401	58.389	77.604	0.453
pilT	Acinetobacter baumannii D1279779	41.451	100	0.417
pilT	Acinetobacter baumannii strain A118	41.451	100	0.417
pilT	Acinetobacter nosocomialis M2	41.451	100	0.417
comGA	Bacillus subtilis subsp. subtilis str. 168	50.993	78.646	0.401
pilT	Legionella pneumophila strain Lp02	46.203	82.292	0.38
pilT	Legionella pneumophila strain ERS1305867	46.203	82.292	0.38
pilT	Pseudomonas stutzeri DSM 10701	45.912	82.813	0.38
pilT	Pseudomonas aeruginosa PAK	45.912	82.813	0.38
pilT	Neisseria meningitidis 8013	45.86	81.771	0.375
pilT	Neisseria gonorrhoeae MS11	45.223	81.771	0.37
pilT	Acinetobacter baylyi ADP1	44.304	82.292	0.365

Detailed information NTG0786908