Detailed information
Overview
| Name | pilC | Type | Machinery gene |
| Locus tag | PL321_RS10500 | Genome accession | NZ_CP117677 |
| Coordinates | 1478215..1478424 (+) | Length | 69 a.a. |
| NCBI ID | WP_273961983.1 | Uniprot ID | - |
| Organism | Caloramator sp. mosi_1 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1473215..1483424
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL321_RS10475 (PL321_10490) | - | 1473925..1474440 (+) | 516 | WP_273961979.1 | hypothetical protein | - |
| PL321_RS10480 (PL321_10495) | - | 1474807..1475034 (+) | 228 | WP_273961980.1 | hypothetical protein | - |
| PL321_RS10485 (PL321_10500) | - | 1475034..1475324 (+) | 291 | WP_273961981.1 | hypothetical protein | - |
| PL321_RS19970 | - | 1475676..1476061 (+) | 386 | Protein_2060 | hypothetical protein | - |
| PL321_RS19975 | - | 1476076..1476414 (+) | 339 | WP_337961152.1 | ATPase, T2SS/T4P/T4SS family | - |
| PL321_RS19980 | pilB | 1476426..1477004 (+) | 579 | WP_337960801.1 | ATPase, T2SS/T4P/T4SS family | Machinery gene |
| PL321_RS10495 (PL321_10510) | - | 1477329..1478222 (+) | 894 | WP_273961982.1 | type II secretion system F family protein | - |
| PL321_RS10500 (PL321_10515) | pilC | 1478215..1478424 (+) | 210 | WP_273961983.1 | type II secretion system F family protein | Machinery gene |
| PL321_RS10505 (PL321_10520) | - | 1478471..1478584 (+) | 114 | Protein_2065 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| PL321_RS10510 (PL321_10525) | - | 1478919..1479425 (+) | 507 | WP_273961984.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| PL321_RS10515 (PL321_10530) | - | 1479631..1479981 (+) | 351 | WP_273961985.1 | hypothetical protein | - |
| PL321_RS10520 (PL321_10535) | pilM | 1479993..1480913 (+) | 921 | WP_273961986.1 | pilus assembly protein PilM | - |
| PL321_RS10525 (PL321_10540) | - | 1480929..1481483 (+) | 555 | WP_273961987.1 | PilN domain-containing protein | - |
| PL321_RS10530 (PL321_10545) | - | 1481489..1482184 (+) | 696 | WP_273961988.1 | hypothetical protein | - |
| PL321_RS10535 (PL321_10550) | - | 1482580..1483281 (+) | 702 | WP_273961989.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 7822.36 Da Isoelectric Point: 4.0332
>NTDB_id=786899 PL321_RS10500 WP_273961983.1 1478215..1478424(+) (pilC) [Caloramator sp. mosi_1]
MIKTGEESGTLEEMLSKLADLYENEVENMVTRLTAVFEPIMIVFLALIVGFMLASIILPMFKLYGNMNF
MIKTGEESGTLEEMLSKLADLYENEVENMVTRLTAVFEPIMIVFLALIVGFMLASIILPMFKLYGNMNF
Nucleotide
Download Length: 210 bp
>NTDB_id=786899 PL321_RS10500 WP_273961983.1 1478215..1478424(+) (pilC) [Caloramator sp. mosi_1]
ATGATTAAGACAGGAGAAGAGAGTGGAACCTTAGAGGAGATGCTCTCTAAACTGGCAGATCTCTATGAAAATGAGGTTGA
GAATATGGTTACAAGACTAACAGCAGTTTTTGAACCTATAATGATTGTATTTTTAGCCCTTATTGTAGGTTTTATGCTGG
CATCAATAATTCTACCAATGTTTAAACTTTACGGAAATATGAATTTTTAA
ATGATTAAGACAGGAGAAGAGAGTGGAACCTTAGAGGAGATGCTCTCTAAACTGGCAGATCTCTATGAAAATGAGGTTGA
GAATATGGTTACAAGACTAACAGCAGTTTTTGAACCTATAATGATTGTATTTTTAGCCCTTATTGTAGGTTTTATGCTGG
CATCAATAATTCTACCAATGTTTAAACTTTACGGAAATATGAATTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilC | Thermus thermophilus HB27 |
51.471 |
98.551 |
0.507 |
| pilG | Neisseria gonorrhoeae MS11 |
52.239 |
97.101 |
0.507 |
| pilG | Neisseria meningitidis 44/76-A |
49.254 |
97.101 |
0.478 |
| pilC | Legionella pneumophila strain ERS1305867 |
50.794 |
91.304 |
0.464 |
| pilC | Pseudomonas stutzeri DSM 10701 |
49.206 |
91.304 |
0.449 |
| pilC | Vibrio campbellii strain DS40M4 |
47.619 |
91.304 |
0.435 |
| pilC | Vibrio cholerae strain A1552 |
47.619 |
91.304 |
0.435 |
| pilC | Acinetobacter baumannii D1279779 |
44.444 |
91.304 |
0.406 |
| pilC | Acinetobacter baylyi ADP1 |
42.857 |
91.304 |
0.391 |