Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | JJN14_RS09980 | Genome accession | NZ_CP067992 |
| Coordinates | 2030120..2030242 (-) | Length | 40 a.a. |
| NCBI ID | WP_020902306.1 | Uniprot ID | A0A501PDA9 |
| Organism | Streptococcus mitis strain S022-V7-A3 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2025120..2035242
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JJN14_RS09955 (JJN14_09955) | - | 2027248..2027790 (+) | 543 | WP_201058573.1 | TetR/AcrR family transcriptional regulator | - |
| JJN14_RS09970 (JJN14_09970) | comE | 2028033..2028785 (-) | 753 | WP_000866073.1 | competence system response regulator transcription factor ComE | Regulator |
| JJN14_RS09975 (JJN14_09975) | comD | 2028782..2030107 (-) | 1326 | WP_201058574.1 | competence system sensor histidine kinase ComD | Regulator |
| JJN14_RS09980 (JJN14_09980) | comC/comC2 | 2030120..2030242 (-) | 123 | WP_020902306.1 | competence-stimulating peptide ComC | Regulator |
| JJN14_RS09990 (JJN14_09990) | rlmH | 2030524..2031003 (-) | 480 | WP_064276841.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| JJN14_RS09995 (JJN14_09995) | htrA | 2031187..2032368 (+) | 1182 | WP_153219714.1 | S1C family serine protease | Regulator |
| JJN14_RS10000 (JJN14_10000) | spo0J | 2032426..2033184 (+) | 759 | WP_049509403.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4746.60 Da Isoelectric Point: 11.0565
>NTDB_id=458284 JJN14_RS09980 WP_020902306.1 2030120..2030242(-) (comC/comC2) [Streptococcus mitis strain S022-V7-A3]
MKNTVKLEQFVALKEKDLQEIRGGETRKTINSLLNLFKRR
MKNTVKLEQFVALKEKDLQEIRGGETRKTINSLLNLFKRR
Nucleotide
Download Length: 123 bp
>NTDB_id=458284 JJN14_RS09980 WP_020902306.1 2030120..2030242(-) (comC/comC2) [Streptococcus mitis strain S022-V7-A3]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAGGAGATTCGAGGTGGGGAAACTAG
AAAAACAATTAATAGTTTACTTAATCTCTTCAAAAGAAGATAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAGGAGATTCGAGGTGGGGAAACTAG
AAAAACAATTAATAGTTTACTTAATCTCTTCAAAAGAAGATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
70 |
100 |
0.7 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
70 |
100 |
0.7 |
| comC | Streptococcus mitis NCTC 12261 |
67.5 |
100 |
0.675 |
| comC | Streptococcus mitis SK321 |
92.593 |
67.5 |
0.625 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
88.889 |
67.5 |
0.6 |
| comC/comC1 | Streptococcus pneumoniae R6 |
88.889 |
67.5 |
0.6 |
| comC/comC1 | Streptococcus pneumoniae G54 |
88.889 |
67.5 |
0.6 |
| comC/comC1 | Streptococcus pneumoniae D39 |
88.889 |
67.5 |
0.6 |