Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPV225_RS00200 Genome accession   NC_017355
Coordinates   35508..35621 (+) Length   37 a.a.
NCBI ID   WP_001217871.1    Uniprot ID   -
Organism   Helicobacter pylori v225d     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30508..40621
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPV225_RS00175 (HPV225_0041) - 30559..32781 (+) 2223 WP_001051548.1 AAA family ATPase -
  HPV225_RS00180 (HPV225_0042) panD 32771..33121 (+) 351 WP_000142290.1 aspartate 1-decarboxylase -
  HPV225_RS00185 (HPV225_0043) - 33132..33434 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HPV225_RS00190 (HPV225_0044) - 33434..34429 (+) 996 WP_000468451.1 PDZ domain-containing protein -
  HPV225_RS00195 (HPV225_0045) comB6 34437..35492 (+) 1056 WP_000786695.1 P-type conjugative transfer protein TrbL Machinery gene
  HPV225_RS00200 (HPV225_0046) comB7 35508..35621 (+) 114 WP_001217871.1 hypothetical protein Machinery gene
  HPV225_RS00205 (HPV225_0047) comB8 35618..36361 (+) 744 WP_000660500.1 type IV secretion system protein Machinery gene
  HPV225_RS00210 (HPV225_0048) comB9 36361..37329 (+) 969 WP_014533574.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPV225_RS00215 (HPV225_0049) comB10 37322..38458 (+) 1137 WP_001045875.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPV225_RS00220 (HPV225_0050) - 38528..39940 (+) 1413 WP_000694831.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=37543 HPV225_RS00200 WP_001217871.1 35508..35621(+) (comB7) [Helicobacter pylori v225d]
MRIFFVIMGLMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=37543 HPV225_RS00200 WP_001217871.1 35508..35621(+) (comB7) [Helicobacter pylori v225d]
ATGAGAATTTTTTTTGTCATTATGGGGCTAATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

94.595

100

0.946


Multiple sequence alignment