Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   D9C08_RS16695 Genome accession   NZ_CP032872
Coordinates   3116539..3116712 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis strain 2KL1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3111539..3121712
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C08_RS16680 (D9C08_16680) gcvT 3112339..3113427 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  D9C08_RS16685 (D9C08_16685) hepAA 3113868..3115541 (+) 1674 WP_038829735.1 SNF2-related protein -
  D9C08_RS16690 (D9C08_16690) yqhG 3115562..3116356 (+) 795 WP_014480249.1 YqhG family protein -
  D9C08_RS16695 (D9C08_16695) sinI 3116539..3116712 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C08_RS16700 (D9C08_16700) sinR 3116746..3117081 (+) 336 WP_121509422.1 transcriptional regulator SinR Regulator
  D9C08_RS16705 (D9C08_16705) tasA 3117174..3117959 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C08_RS16710 (D9C08_16710) sipW 3118023..3118595 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C08_RS16715 (D9C08_16715) tapA 3118579..3119340 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C08_RS16720 (D9C08_16720) yqzG 3119612..3119938 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C08_RS16725 (D9C08_16725) spoIITA 3119980..3120159 (-) 180 WP_014480252.1 YqzE family protein -
  D9C08_RS16730 (D9C08_16730) comGG 3120230..3120604 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C08_RS16735 (D9C08_16735) comGF 3120605..3120988 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  D9C08_RS16740 (D9C08_16740) comGE 3121014..3121361 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=280264 D9C08_RS16695 WP_003230187.1 3116539..3116712(+) (sinI) [Bacillus subtilis subsp. subtilis strain 2KL1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=280264 D9C08_RS16695 WP_003230187.1 3116539..3116712(+) (sinI) [Bacillus subtilis subsp. subtilis strain 2KL1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment