Detailed information NTG0274119

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LL267_RS11365
• Genome accession: NZ_CP032058
• Coordinates: 2218279..2218548 (-)
• Length: 89 a.a.
• NCBI ID: WP_003129998.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain 267
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2213279..2223548

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LL267_RS11325 (LL267_2175)	-	2213535..2214272 (-)	738	WP_058221575.1	metal ABC transporter ATP-binding protein	-
LL267_RS11330 (LL267_2176)	-	2214449..2215291 (-)	843	WP_003129990.1	metal ABC transporter substrate-binding protein	-
LL267_RS11335 (LL267_2177)	-	2215288..2215725 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
LL267_RS11340 (LL267_2178)	-	2215932..2216879 (+)	948	WP_003130410.1	IS30 family transposase	-
LL267_RS11345 (LL267_2179)	comGG	2216853..2217179 (-)	327	WP_058221568.1	competence type IV pilus minor pilin ComGG	Machinery gene
LL267_RS11350 (LL267_2180)	comGF	2217229..2217657 (-)	429	Protein_2210	competence type IV pilus minor pilin ComGF	-
LL267_RS11355 (LL267_2181)	comGE	2217620..2217916 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LL267_RS11360 (LL267_2182)	comGD	2217888..2218319 (-)	432	WP_080585155.1	competence type IV pilus minor pilin ComGD	Machinery gene
LL267_RS11365 (LL267_2183)	comGC	2218279..2218548 (-)	270	WP_003129998.1	competence type IV pilus major pilin ComGC	Machinery gene
LL267_RS11370 (LL267_2184)	-	2218675..2219367 (-)	693	WP_152994386.1	hypothetical protein	-
LL267_RS11375 (LL267_2185)	-	2219609..2220388 (-)	780	WP_082225220.1	peptidoglycan amidohydrolase family protein	-
LL267_RS11380 (LL267_2186)	-	2220388..2220687 (-)	300	WP_031559226.1	phage holin	-
LL267_RS11385 (LL267_2187)	-	2220700..2221050 (-)	351	WP_014570798.1	hypothetical protein	-
LL267_RS11390 (LL267_2188)	-	2221063..2221299 (-)	237	WP_082225257.1	hypothetical protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10123.56 Da
• Isoelectric Point: 4.2950

>NTDB_id=274119 LL267_RS11365 WP_003129998.1 2218279..2218548(-) (comGC) [Lactococcus lactis subsp. lactis strain 267]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND

Nucleotide

• Length: 270 bp

>NTDB_id=274119 LL267_RS11365 WP_003129998.1 2218279..2218548(-) (comGC) [Lactococcus lactis subsp. lactis strain 267]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	86.667	84.27	0.73
comGC/cglC	Streptococcus pneumoniae Rx1	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae D39	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae R6	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae TIGR4	55.056	100	0.551
comGC	Streptococcus gordonii str. Challis substr. CH1	56.471	95.506	0.539
comGC	Streptococcus suis isolate S10	58.904	82.022	0.483
comGC/cglC	Streptococcus mitis SK321	53.947	85.393	0.461
comGC	Streptococcus mutans UA140	50.685	82.022	0.416
comGC	Streptococcus mutans UA159	50.685	82.022	0.416
comGC/cglC	Streptococcus mitis NCTC 12261	56.25	71.91	0.404