Detailed information NTG0209960

Bioinformatically predicted

Overview

• Name: pilE
• Type: Machinery gene
• Locus tag: BTU49_RS14345
• Genome accession: NZ_CP018756
• Coordinates: 3144154..3144588 (-)
• Length: 144 a.a.
• NCBI ID: WP_079222951.1
• Uniprot ID: -
• Organism: Stenotrophomonas maltophilia strain AA1
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3122266..3144076	3144154..3144588	flank	78

Gene organization within MGE regions

Location: 3122266..3144588

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BTU49_RS14255	-	3122266..3122940 (+)	675	WP_079222934.1	hypothetical protein	-
BTU49_RS14260	-	3122934..3123947 (+)	1014	WP_079222935.1	hypothetical protein	-
BTU49_RS14265	-	3123941..3124957 (+)	1017	WP_079222936.1	TraB/GumN family protein	-
BTU49_RS14275	-	3125621..3127354 (+)	1734	WP_152027108.1	ABC transporter transmembrane domain-containing protein	-
BTU49_RS14280	sucD	3127473..3128348 (-)	876	WP_005410793.1	succinate--CoA ligase subunit alpha	-
BTU49_RS14285	sucC	3128370..3129539 (-)	1170	WP_079222939.1	ADP-forming succinate--CoA ligase subunit beta	-
BTU49_RS14290	-	3129974..3131587 (+)	1614	WP_079222940.1	ATP-binding protein	-
BTU49_RS14295	pilR	3131643..3133016 (+)	1374	WP_079222941.1	sigma-54 dependent transcriptional regulator	Regulator
BTU49_RS14300	pilB	3133139..3134869 (-)	1731	WP_079222942.1	type IV-A pilus assembly ATPase PilB	Machinery gene
BTU49_RS14305	-	3135144..3136019 (+)	876	WP_079222943.1	glycosyltransferase family 2 protein	-
BTU49_RS14310	-	3136016..3137179 (+)	1164	WP_079222944.1	glycosyltransferase family 4 protein	-
BTU49_RS14315	-	3137330..3138580 (+)	1251	WP_108747253.1	oligosaccharide flippase family protein	-
BTU49_RS14320	-	3138543..3139658 (-)	1116	WP_079222946.1	glycosyltransferase	-
BTU49_RS14325	-	3139655..3140515 (-)	861	WP_161490384.1	FkbM family methyltransferase	-
BTU49_RS14330	-	3140624..3141739 (+)	1116	WP_079222948.1	glycosyltransferase	-
BTU49_RS14335	-	3141725..3142141 (-)	417	WP_079222949.1	pilin	-
BTU49_RS14340	-	3142145..3144076 (-)	1932	WP_079222950.1	hypothetical protein	-
BTU49_RS14345	pilE	3144154..3144588 (-)	435	WP_079222951.1	pilin	Machinery gene

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 14779.02 Da
• Isoelectric Point: 9.6132

>NTDB_id=209960 BTU49_RS14345 WP_079222951.1 3144154..3144588(-) (pilE) [Stenotrophomonas maltophilia strain AA1]
MKNQKGFTLIELMIVVAIIAILAAIALPAYQDYVARSQVSEAMTLSGGAKTAVTEYYADKGAFPDTNAKAGLAPAASING
KYVLSVGLSGNGVITATMKGASSASSKIASKTFVMTPADAGGSITWDCKSTGTIDAKYRPSSCR

Nucleotide

• Length: 435 bp

>NTDB_id=209960 BTU49_RS14345 WP_079222951.1 3144154..3144588(-) (pilE) [Stenotrophomonas maltophilia strain AA1]
ATGAAGAACCAGAAGGGCTTCACCCTCATCGAACTGATGATCGTCGTCGCGATCATCGCGATCCTGGCCGCCATCGCTCT
GCCGGCTTACCAGGACTATGTCGCTCGCTCGCAGGTCTCCGAAGCGATGACCCTGAGCGGCGGCGCCAAGACCGCTGTCA
CCGAGTACTACGCTGACAAGGGTGCCTTCCCGGACACCAATGCCAAGGCTGGCCTCGCTCCGGCTGCTTCGATCAACGGC
AAGTACGTCCTCAGCGTCGGCCTGAGCGGCAATGGCGTGATCACCGCCACCATGAAGGGCGCCTCCTCGGCCAGCTCGAA
GATCGCCAGCAAGACCTTCGTCATGACCCCGGCTGATGCCGGCGGCTCGATCACCTGGGATTGCAAGAGCACCGGCACCA
TCGACGCCAAGTACCGCCCGTCTTCCTGCCGCTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (35-144)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria gonorrhoeae MS11	49.045	100	0.535
pilA2	Legionella pneumophila str. Paris	53.147	99.306	0.528
pilA2	Legionella pneumophila strain ERS1305867	52.448	99.306	0.521
pilE	Neisseria gonorrhoeae strain FA1090	46.795	100	0.507
comP	Acinetobacter baylyi ADP1	45.098	100	0.479
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	36.957	100	0.472
pilA/pilA1	Eikenella corrodens VA1	41.401	100	0.451
pilA	Acinetobacter baumannii strain A118	41.333	100	0.431
pilA	Acinetobacter nosocomialis M2	45.455	91.667	0.417
pilA	Ralstonia pseudosolanacearum GMI1000	35.928	100	0.417
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	38.667	100	0.403
pilA	Vibrio cholerae strain A1552	38.667	100	0.403
pilA	Vibrio cholerae C6706	38.667	100	0.403
pilA	Pseudomonas aeruginosa PAK	37.419	100	0.403
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40.426	97.917	0.396
pilA	Vibrio campbellii strain DS40M4	36.242	100	0.375
pilA	Haemophilus influenzae 86-028NP	38.298	97.917	0.375
pilA/pilAII	Pseudomonas stutzeri DSM 10701	37.589	97.917	0.368
pilA	Haemophilus influenzae Rd KW20	36.879	97.917	0.361