Detailed information NTG1003193

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: ABHI23_RS16360
• Genome accession: NZ_CP156913
• Coordinates: 3842199..3842390 (-)
• Length: 63 a.a.
• NCBI ID: WP_157380112.1
• Uniprot ID: -
• Organism: Xanthomonas citri pv. mangiferaeindicae strain CFBP 1716
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	3841149..3854326	3842199..3842390	within	0

Gene organization within MGE regions

Location: 3841149..3854326

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABHI23_RS16355 (ABHI23_16355)	-	3841149..3842111 (-)	963	WP_103791079.1	IS1595-like element IS1595 family transposase	-
ABHI23_RS16360 (ABHI23_16360)	pilA2	3842199..3842390 (-)	192	WP_157380112.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
ABHI23_RS16365 (ABHI23_16365)	comP	3842487..3842915 (-)	429	WP_005921364.1	pilin	Machinery gene
ABHI23_RS16370 (ABHI23_16370)	pilC	3843260..3844519 (+)	1260	WP_033483308.1	type II secretion system F family protein	Machinery gene
ABHI23_RS16375 (ABHI23_16375)	-	3844526..3845389 (+)	864	WP_003491180.1	A24 family peptidase	-
ABHI23_RS16380 (ABHI23_16380)	coaE	3845403..3846011 (+)	609	WP_003491178.1	dephospho-CoA kinase	-
ABHI23_RS16385 (ABHI23_16385)	-	3846109..3847071 (+)	963	WP_103791079.1	IS1595-like element IS1595 family transposase	-
ABHI23_RS16390 (ABHI23_16390)	-	3847888..3849044 (+)	1157	WP_087942126.1	IS3-like element ISXc8 family transposase	-
ABHI23_RS16395 (ABHI23_16395)	-	3849049..3853119 (-)	4071	Protein_3214	RHS repeat-associated core domain-containing protein	-
ABHI23_RS16400 (ABHI23_16400)	-	3853364..3854326 (-)	963	WP_103791079.1	IS1595-like element IS1595 family transposase	-

Sequence

Protein

• Length: 63 a.a.
• Molecular weight: 6647.79 Da
• Isoelectric Point: 6.1034

>NTDB_id=1003193 ABHI23_RS16360 WP_157380112.1 3842199..3842390(-) (pilA2) [Xanthomonas citri pv. mangiferaeindicae strain CFBP 1716]
MSRVNGFTLLELMIVVAIVGILSALALPAYQSYVIKARVTEAIILADSAKAAVTQNVNNENAS

Nucleotide

• Length: 192 bp

>NTDB_id=1003193 ABHI23_RS16360 WP_157380112.1 3842199..3842390(-) (pilA2) [Xanthomonas citri pv. mangiferaeindicae strain CFBP 1716]
ATGAGCCGGGTAAACGGTTTCACCTTGCTCGAGCTAATGATCGTCGTGGCCATCGTCGGGATATTGTCTGCATTGGCCCT
GCCGGCTTATCAAAGTTATGTAATCAAGGCGCGCGTGACCGAAGCTATTATTTTGGCTGACTCTGCCAAAGCTGCGGTGA
CTCAGAATGTCAATAATGAAAATGCTTCCTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila str. Paris	65	95.238	0.619
pilA2	Legionella pneumophila strain ERS1305867	65	95.238	0.619
pilA	Ralstonia pseudosolanacearum GMI1000	65.455	87.302	0.571
pilE	Neisseria gonorrhoeae strain FA1090	66.667	80.952	0.54
pilE	Neisseria gonorrhoeae MS11	68	79.365	0.54
comP	Acinetobacter baylyi ADP1	51.613	98.413	0.508
pilA	Vibrio campbellii strain DS40M4	58.491	84.127	0.492
pilA	Acinetobacter nosocomialis M2	54.386	90.476	0.492
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	52.632	90.476	0.476
pilA	Acinetobacter baumannii strain A118	48.387	98.413	0.476
pilA/pilAII	Pseudomonas stutzeri DSM 10701	48.333	95.238	0.46
pilA/pilAI	Pseudomonas stutzeri DSM 10701	50.943	84.127	0.429
pilL	Neisseria gonorrhoeae MS11	43.333	95.238	0.413
pilX	Neisseria meningitidis 8013	41.935	98.413	0.413
pilA	Haemophilus influenzae 86-028NP	52.083	76.19	0.397
pilA/pilA1	Eikenella corrodens VA1	65.789	60.317	0.397
pilA	Vibrio parahaemolyticus RIMD 2210633	58.537	65.079	0.381
pilA	Pseudomonas aeruginosa PAK	55.814	68.254	0.381
pilA	Glaesserella parasuis strain SC1401	48.936	74.603	0.365