Detailed information NTG1003194

Bioinformatically predicted

Overview

• Name: comP
• Type: Machinery gene
• Locus tag: ABHI23_RS16365
• Genome accession: NZ_CP156913
• Coordinates: 3842487..3842915 (-)
• Length: 142 a.a.
• NCBI ID: WP_005921364.1
• Uniprot ID: -
• Organism: Xanthomonas citri pv. mangiferaeindicae strain CFBP 1716
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	3841149..3854326	3842487..3842915	within	0

Gene organization within MGE regions

Location: 3841149..3854326

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABHI23_RS16355 (ABHI23_16355)	-	3841149..3842111 (-)	963	WP_103791079.1	IS1595-like element IS1595 family transposase	-
ABHI23_RS16360 (ABHI23_16360)	pilA2	3842199..3842390 (-)	192	WP_157380112.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
ABHI23_RS16365 (ABHI23_16365)	comP	3842487..3842915 (-)	429	WP_005921364.1	pilin	Machinery gene
ABHI23_RS16370 (ABHI23_16370)	pilC	3843260..3844519 (+)	1260	WP_033483308.1	type II secretion system F family protein	Machinery gene
ABHI23_RS16375 (ABHI23_16375)	-	3844526..3845389 (+)	864	WP_003491180.1	A24 family peptidase	-
ABHI23_RS16380 (ABHI23_16380)	coaE	3845403..3846011 (+)	609	WP_003491178.1	dephospho-CoA kinase	-
ABHI23_RS16385 (ABHI23_16385)	-	3846109..3847071 (+)	963	WP_103791079.1	IS1595-like element IS1595 family transposase	-
ABHI23_RS16390 (ABHI23_16390)	-	3847888..3849044 (+)	1157	WP_087942126.1	IS3-like element ISXc8 family transposase	-
ABHI23_RS16395 (ABHI23_16395)	-	3849049..3853119 (-)	4071	Protein_3214	RHS repeat-associated core domain-containing protein	-
ABHI23_RS16400 (ABHI23_16400)	-	3853364..3854326 (-)	963	WP_103791079.1	IS1595-like element IS1595 family transposase	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 14513.65 Da
• Isoelectric Point: 8.4798

>NTDB_id=1003194 ABHI23_RS16365 WP_005921364.1 3842487..3842915(-) (comP) [Xanthomonas citri pv. mangiferaeindicae strain CFBP 1716]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTIRSRVSELAVMASSFKTTVAENIANNGGTLPADACVGVGATAATTN
MASIACTPATGNIVVTGDATRTKGTVLTYAPTVGGANSAVGTTWTCTGSGSQSKYYPAECRR

Nucleotide

• Length: 429 bp

>NTDB_id=1003194 ABHI23_RS16365 WP_005921364.1 3842487..3842915(-) (comP) [Xanthomonas citri pv. mangiferaeindicae strain CFBP 1716]
ATGAAGAAGCAACAAGGCTTTACCCTGATCGAATTGATGATCGTTGTTGCGATCATCGCAATCCTGGCCGCCATTGCTCT
TCCGGCTTATCAGGACTACACCATTCGCTCGCGTGTTTCGGAACTGGCCGTGATGGCTAGCTCCTTTAAGACGACCGTTG
CGGAAAACATCGCCAACAACGGCGGCACCCTGCCAGCTGACGCTTGCGTCGGCGTTGGTGCTACCGCTGCGACCACTAAT
ATGGCTTCCATCGCTTGCACTCCCGCGACTGGCAACATCGTCGTAACCGGCGATGCAACTCGGACCAAGGGCACCGTTTT
GACCTATGCTCCGACAGTGGGCGGTGCTAACTCGGCGGTTGGTACCACTTGGACCTGCACCGGCAGTGGTAGCCAGTCCA
AGTACTATCCGGCCGAGTGCCGCCGCTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (36-141)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comP	Acinetobacter baylyi ADP1	54.305	100	0.577
pilA2	Legionella pneumophila str. Paris	55.319	99.296	0.549
pilA2	Legionella pneumophila strain ERS1305867	54.61	99.296	0.542
pilA	Ralstonia pseudosolanacearum GMI1000	41.463	100	0.479
pilA	Pseudomonas aeruginosa PAK	37.58	100	0.415
pilA/pilA1	Eikenella corrodens VA1	38.411	100	0.408
pilE	Neisseria gonorrhoeae strain FA1090	34.94	100	0.408
pilA/pilAII	Pseudomonas stutzeri DSM 10701	40.278	100	0.408
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40.559	100	0.408
pilA	Haemophilus influenzae 86-028NP	38.971	95.775	0.373
pilA	Vibrio parahaemolyticus RIMD 2210633	40.31	90.845	0.366