NTDB

Overview

Name	Cj0011c	Type	Machinery gene
Locus tag	WHP53_RS07560	Genome accession	NZ_CP148242
Coordinates	1460995..1461234 (+)	Length	79 a.a.
NCBI ID	WP_002866798.1	Uniprot ID	Q3HR28
Organism	Campylobacter jejuni strain Z1323CCJ0010
Function	DNA binding (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1455995..1466234

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
WHP53_RS07540 (WHP53_07545)	-	1456593..1457819 (+)	1227	WP_002888390.1	HD domain-containing protein	-
WHP53_RS07545 (WHP53_07550)	-	1457911..1458435 (+)	525	WP_002857701.1	YagU family protein	-
WHP53_RS07550 (WHP53_07555)	ilvD	1458447..1460123 (-)	1677	WP_002857690.1	dihydroxy-acid dehydratase	-
WHP53_RS07555 (WHP53_07560)	rrc	1460283..1460930 (+)	648	WP_002855562.1	ferritin family protein	-
WHP53_RS07560 (WHP53_07565)	Cj0011c	1460995..1461234 (+)	240	WP_002866798.1	ComEA family DNA-binding protein	Machinery gene
WHP53_RS07565 (WHP53_07570)	rnhB	1461267..1461842 (+)	576	WP_002866799.1	ribonuclease HII	-
WHP53_RS07570 (WHP53_07575)	gltD	1461843..1463288 (-)	1446	WP_002866800.1	glutamate synthase subunit beta	-

Sequence

Protein

Download Length: 79 a.a. Molecular weight: 8854.48 Da Isoelectric Point: 10.1677

                                >NTDB_id=953335 WHP53_RS07560 WP_002866798.1 1460995..1461234(+) (Cj0011c) [Campylobacter jejuni strain Z1323CCJ0010]

MKKLLFLFFALTAFLFGAVNINTATLKELKSLNGIGEAKAKSILEYRKEANFTSIDDLKKVKGIGDKLFEKIKNDITVE

Nucleotide

Download Length: 240 bp

                                >NTDB_id=953335 WHP53_RS07560 WP_002866798.1 1460995..1461234(+) (Cj0011c) [Campylobacter jejuni strain Z1323CCJ0010]

ATGAAAAAATTACTATTTTTATTTTTTGCTTTAACGGCTTTTCTCTTTGGTGCTGTAAATATCAACACTGCAACGCTAAA

AGAATTAAAAAGTTTAAATGGTATTGGCGAAGCTAAGGCTAAATCGATTTTAGAATACCGCAAAGAAGCAAATTTTACAA

GTATTGATGATCTTAAAAAAGTTAAAGGCATAGGTGATAAGCTTTTTGAAAAAATCAAAAATGATATCACAGTAGAATAA

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(18-77)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	Q3HR28

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	97.468	100	0.975
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comEA	Bacillus subtilis subsp. subtilis str. 168	57.377	77.215	0.443
comEA	Acinetobacter baylyi ADP1	54.098	77.215	0.418
comEA	Staphylococcus aureus MW2	54.098	77.215	0.418
comEA	Staphylococcus aureus N315	54.098	77.215	0.418
comEA/celA/cilE	Streptococcus pneumoniae TIGR4	50.794	79.747	0.405
comEA/celA/cilE	Streptococcus pneumoniae Rx1	50.794	79.747	0.405
comEA/celA/cilE	Streptococcus pneumoniae D39	50.794	79.747	0.405
comEA/celA/cilE	Streptococcus pneumoniae R6	50.794	79.747	0.405
comEA/celA/cilE	Streptococcus mitis NCTC 12261	50.794	79.747	0.405
comEA	Lactococcus lactis subsp. cremoris KW2	51.613	78.481	0.405
comEA	Vibrio cholerae C6706	60.784	64.557	0.392
comEA	Vibrio cholerae strain A1552	60.784	64.557	0.392
comEA/celA/cilE	Streptococcus mitis SK321	49.206	79.747	0.392
comE1/comEA	Haemophilus influenzae Rd KW20	49.153	74.684	0.367
comEA/comE1	Glaesserella parasuis strain SC1401	46.032	79.747	0.367
comEA	Acinetobacter baumannii D1279779	46.032	79.747	0.367
comEA	Vibrio parahaemolyticus RIMD 2210633	48.333	75.949	0.367
comEA	Vibrio campbellii strain DS40M4	48.333	75.949	0.367

Detailed information NTG0953335