NTDB

Overview

Name	pilA2	Type	Machinery gene
Locus tag	OXA86_RS09490	Genome accession	NZ_CP113439
Coordinates	2091739..2092149 (-)	Length	136 a.a.
NCBI ID	WP_011214168.1	Uniprot ID	A0AAX2J0V3
Organism	Legionella pneumophila strain PATHC002
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2086739..2097149

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OXA86_RS09475 (OXA86_09475)	letS	2087057..2089789 (+)	2733	WP_014841967.1	two-component system sensor histidine kinase LetS	Regulator
OXA86_RS09480 (OXA86_09480)	-	2089887..2091131 (+)	1245	WP_011214166.1	6-phosphofructokinase	-
OXA86_RS09485 (OXA86_09485)	pilA2	2091128..2091541 (-)	414	WP_013101573.1	pilin	Machinery gene
OXA86_RS09490 (OXA86_09490)	pilA2	2091739..2092149 (-)	411	WP_011214168.1	pilin	Machinery gene
OXA86_RS09495 (OXA86_09495)	-	2092452..2092769 (+)	318	WP_014841968.1	BolA family protein	-
OXA86_RS09500 (OXA86_09500)	-	2092844..2094265 (+)	1422	WP_014841969.1	APC family permease	-
OXA86_RS09505 (OXA86_09505)	-	2094363..2095793 (-)	1431	WP_014841970.1	cellulase family glycosylhydrolase	-
OXA86_RS09510 (OXA86_09510)	kdsB	2096041..2096793 (-)	753	WP_014841971.1	3-deoxy-manno-octulosonate cytidylyltransferase	-
OXA86_RS09515 (OXA86_09515)	-	2096790..2096969 (-)	180	WP_010947637.1	Trm112 family protein	-

Sequence

Protein

Download Length: 136 a.a. Molecular weight: 13854.07 Da Isoelectric Point: 8.4715

                                >NTDB_id=762246 OXA86_RS09490 WP_011214168.1 2091739..2092149(-) (pilA2) [Legionella pneumophila strain PATHC002]

MRQKGFTLIELMIVVAIIGILAAIAIPAYQDYTIRARVTEGLTLADSAKLAVSETAITNNALPATQAATGYVSPAATPNV

ASIAIGANGVITITYTAAAGGGTIVMTPTLQANGDVTWTCTGGTLLAKYRPASCRP

Nucleotide

Download Length: 411 bp

                                >NTDB_id=762246 OXA86_RS09490 WP_011214168.1 2091739..2092149(-) (pilA2) [Legionella pneumophila strain PATHC002]

ATGAGACAAAAGGGTTTTACTTTAATTGAATTGATGATAGTCGTAGCGATTATCGGTATTTTGGCAGCAATCGCTATACC

AGCCTATCAAGATTACACAATACGAGCTCGTGTTACAGAAGGTCTGACCTTGGCAGATTCTGCAAAACTTGCCGTATCTG

AAACGGCTATTACCAACAACGCGTTACCAGCTACTCAGGCTGCAACGGGCTACGTGTCTCCCGCTGCTACGCCGAATGTA

GCATCAATTGCTATTGGTGCCAACGGAGTGATTACCATAACGTATACTGCTGCAGCAGGTGGTGGTACCATAGTTATGAC

CCCAACCTTACAAGCTAACGGTGATGTAACCTGGACTTGTACGGGTGGTACTTTGTTGGCCAAATACCGACCTGCCAGTT

GCAGACCATAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(35-135)

Prokaryotic N-terminal methylation motif (N_methyl)

(2-25)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA2	Legionella pneumophila str. Paris	100	100	1
pilA2	Legionella pneumophila strain ERS1305867	98.529	100	0.985
pilA	Ralstonia pseudosolanacearum GMI1000	49.689	100	0.588
comP	Acinetobacter baylyi ADP1	53.793	100	0.574
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	37.566	100	0.522
pilA/pilA1	Eikenella corrodens VA1	39.873	100	0.463
pilA	Haemophilus influenzae 86-028NP	40.816	100	0.441
pilE	Neisseria gonorrhoeae strain FA1090	36.943	100	0.426
pilA/pilAI	Pseudomonas stutzeri DSM 10701	42.963	99.265	0.426
pilA	Acinetobacter baumannii strain A118	39.726	100	0.426
pilA	Pseudomonas aeruginosa PAK	39.189	100	0.426
pilE	Neisseria gonorrhoeae MS11	37.179	100	0.426
pilA	Haemophilus influenzae Rd KW20	44.094	93.382	0.412
pilA	Vibrio cholerae C6706	38.462	100	0.404
pilA	Vibrio cholerae strain A1552	38.462	100	0.404
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	38.462	100	0.404
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.855	100	0.404
pilA	Glaesserella parasuis strain SC1401	37.5	100	0.375
pilA	Vibrio parahaemolyticus RIMD 2210633	38.462	95.588	0.368

Detailed information NTG0762246