Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   QL281_RS06945 Genome accession   NZ_CP125292
Coordinates   1260346..1260486 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM117797     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1255346..1265486
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QL281_RS06920 (QL281_06920) yuxO 1255623..1256003 (-) 381 WP_041052848.1 hotdog fold thioesterase -
  QL281_RS06925 (QL281_06925) comA 1256022..1256666 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QL281_RS06930 (QL281_06930) comP 1256747..1259059 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  QL281_RS06935 (QL281_06935) comX 1259075..1259296 (-) 222 WP_014480704.1 competence pheromone ComX -
  QL281_RS06940 (QL281_06940) comQ 1259298..1260161 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  QL281_RS06945 (QL281_06945) degQ 1260346..1260486 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QL281_RS06950 (QL281_06950) - 1260708..1260833 (+) 126 WP_003228793.1 hypothetical protein -
  QL281_RS06955 (QL281_06955) - 1260947..1261315 (+) 369 WP_014477834.1 hypothetical protein -
  QL281_RS06960 (QL281_06960) pdeH 1261291..1262520 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  QL281_RS06965 (QL281_06965) pncB 1262657..1264129 (-) 1473 WP_041352162.1 nicotinate phosphoribosyltransferase -
  QL281_RS06970 (QL281_06970) pncA 1264145..1264696 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  QL281_RS06975 (QL281_06975) yueI 1264793..1265191 (-) 399 WP_017695530.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=762244 QL281_RS06945 WP_003220708.1 1260346..1260486(-) (degQ) [Bacillus subtilis strain SRCM117797]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=762244 QL281_RS06945 WP_003220708.1 1260346..1260486(-) (degQ) [Bacillus subtilis strain SRCM117797]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1