Detailed information
Bioinformatically predicted
Overview
| Name | dprA | Type | Machinery gene |
| Locus tag | KM392_RS28770 | Genome accession | NZ_CP076219 |
| Coordinates | 3632335..3632625 (-) | Length | 96 a.a. |
| NCBI ID | WP_324254321.1 | Uniprot ID | - |
| Organism | Bacillus anthracis strain AF039 | ||
| Function | ssDNA binding; loading RecA onto ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 3590615..3664540 | 3632335..3632625 | within | 0 |
Gene organization within MGE regions
Location: 3590615..3664540
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KM392_RS18685 (KM392_18690) | - | 3590958..3592628 (-) | 1671 | WP_000823085.1 | ribonuclease J | - |
| KM392_RS18690 (KM392_18695) | dapA | 3593394..3594272 (-) | 879 | WP_000564767.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| KM392_RS18695 (KM392_18700) | dapG | 3594284..3595516 (-) | 1233 | WP_000692470.1 | aspartate kinase | - |
| KM392_RS18700 (KM392_18705) | asd | 3595540..3596586 (-) | 1047 | WP_000414849.1 | aspartate-semialdehyde dehydrogenase | - |
| KM392_RS18705 (KM392_18710) | dpaB | 3596737..3597336 (-) | 600 | WP_001049484.1 | dipicolinate synthase subunit B | - |
| KM392_RS18710 (KM392_18715) | dpaA | 3597333..3598235 (-) | 903 | WP_000954726.1 | dipicolinic acid synthetase subunit A | - |
| KM392_RS18715 (KM392_18720) | - | 3598510..3598761 (-) | 252 | WP_001239752.1 | YlmC/YmxH family sporulation protein | - |
| KM392_RS18720 (KM392_18725) | - | 3598888..3600129 (-) | 1242 | WP_000592993.1 | pitrilysin family protein | - |
| KM392_RS18725 (KM392_18730) | - | 3600216..3601115 (-) | 900 | WP_000647529.1 | polysaccharide deacetylase family protein | - |
| KM392_RS18730 (KM392_18735) | pnp | 3601267..3603405 (-) | 2139 | WP_000076750.1 | polyribonucleotide nucleotidyltransferase | - |
| KM392_RS18735 (KM392_18740) | rpsO | 3603566..3603835 (-) | 270 | WP_001229392.1 | 30S ribosomal protein S15 | - |
| KM392_RS18740 (KM392_18745) | ribF | 3603936..3604907 (-) | 972 | WP_000766711.1 | bifunctional riboflavin kinase/FAD synthetase | - |
| KM392_RS18745 (KM392_18750) | truB | 3604951..3605874 (-) | 924 | WP_000399357.1 | tRNA pseudouridine(55) synthase TruB | - |
| KM392_RS18750 (KM392_18755) | rbfA | 3605961..3606317 (-) | 357 | WP_000776441.1 | 30S ribosome-binding factor RbfA | - |
| KM392_RS18755 (KM392_18760) | - | 3606333..3606614 (-) | 282 | WP_000582364.1 | DUF503 family protein | - |
| KM392_RS18760 (KM392_18765) | infB | 3606611..3608671 (-) | 2061 | WP_000036340.1 | translation initiation factor IF-2 | - |
| KM392_RS18765 (KM392_18770) | - | 3608676..3608987 (-) | 312 | WP_001286523.1 | YlxQ family RNA-binding protein | - |
| KM392_RS18770 (KM392_18775) | - | 3608988..3609260 (-) | 273 | WP_000071128.1 | YlxR family protein | - |
| KM392_RS18775 (KM392_18780) | nusA | 3609272..3610378 (-) | 1107 | WP_000102606.1 | transcription termination factor NusA | - |
| KM392_RS18780 (KM392_18785) | rimP | 3610396..3610866 (-) | 471 | WP_000359097.1 | ribosome maturation factor RimP | - |
| KM392_RS18785 (KM392_18790) | - | 3611199..3615500 (-) | 4302 | WP_000059983.1 | PolC-type DNA polymerase III | - |
| KM392_RS18790 (KM392_18795) | - | 3615625..3617325 (-) | 1701 | WP_000814312.1 | proline--tRNA ligase | - |
| KM392_RS18795 (KM392_18800) | rseP | 3617435..3618691 (-) | 1257 | WP_001090228.1 | RIP metalloprotease RseP | - |
| KM392_RS18800 (KM392_18805) | dxr | 3618708..3619850 (-) | 1143 | WP_000790359.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| KM392_RS18805 (KM392_18810) | cdsA | 3619874..3620665 (-) | 792 | WP_000813581.1 | phosphatidate cytidylyltransferase | - |
| KM392_RS18810 (KM392_18815) | uppS | 3620683..3621459 (-) | 777 | WP_033648581.1 | isoprenyl transferase | - |
| KM392_RS18815 (KM392_18820) | frr | 3621545..3622102 (-) | 558 | WP_000531503.1 | ribosome recycling factor | - |
| KM392_RS18820 (KM392_18825) | pyrH | 3622105..3622827 (-) | 723 | WP_000042663.1 | UMP kinase | - |
| KM392_RS18825 (KM392_18830) | tsf | 3622894..3623781 (-) | 888 | WP_001018581.1 | translation elongation factor Ts | - |
| KM392_RS18830 (KM392_18835) | rpsB | 3623885..3624586 (-) | 702 | WP_000111483.1 | 30S ribosomal protein S2 | - |
| KM392_RS18835 (KM392_18840) | codY | 3624936..3625715 (-) | 780 | WP_000421288.1 | GTP-sensing pleiotropic transcriptional regulator CodY | Regulator |
| KM392_RS18840 (KM392_18845) | hslU | 3625793..3627184 (-) | 1392 | WP_000550088.1 | ATP-dependent protease ATPase subunit HslU | - |
| KM392_RS18845 (KM392_18850) | hslV | 3627207..3627749 (-) | 543 | WP_000526272.1 | ATP-dependent protease proteolytic subunit HslV | - |
| KM392_RS18850 (KM392_18855) | xerC | 3627792..3628691 (-) | 900 | WP_001101226.1 | tyrosine recombinase XerC | - |
| KM392_RS18855 (KM392_18860) | trmFO | 3628757..3630061 (-) | 1305 | WP_001991958.1 | FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO | - |
| KM392_RS18860 (KM392_18865) | topA | 3630112..3632190 (-) | 2079 | WP_001286969.1 | type I DNA topoisomerase | - |
| KM392_RS28770 | dprA | 3632335..3632625 (-) | 291 | WP_324254321.1 | DNA-processing protein DprA | Machinery gene |
| KM392_RS28775 | - | 3632538..3632738 (-) | 201 | WP_264371026.1 | DNA-protecting protein DprA | - |
| KM392_RS28780 | - | 3632728..3633204 (-) | 477 | WP_264371027.1 | DNA-protecting protein DprA | - |
| KM392_RS18870 (KM392_18875) | sucD | 3633292..3634194 (-) | 903 | WP_000115178.1 | succinate--CoA ligase subunit alpha | - |
| KM392_RS18875 (KM392_18880) | sucC | 3634215..3635375 (-) | 1161 | WP_001020786.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| KM392_RS18880 (KM392_18885) | rnhB | 3635569..3636342 (-) | 774 | WP_001174712.1 | ribonuclease HII | - |
| KM392_RS18885 (KM392_18890) | ylqF | 3636394..3637284 (-) | 891 | WP_000236707.1 | ribosome biogenesis GTPase YlqF | - |
| KM392_RS18890 (KM392_18895) | lepB | 3637305..3637856 (-) | 552 | WP_000711857.1 | signal peptidase I | - |
| KM392_RS18895 (KM392_18900) | rplS | 3637958..3638302 (-) | 345 | WP_001186516.1 | 50S ribosomal protein L19 | - |
| KM392_RS18900 (KM392_18905) | trmD | 3638449..3639183 (-) | 735 | WP_000686892.1 | tRNA (guanosine(37)-N1)-methyltransferase TrmD | - |
| KM392_RS18905 (KM392_18910) | rimM | 3639183..3639698 (-) | 516 | WP_000170269.1 | ribosome maturation factor RimM | - |
| KM392_RS18910 (KM392_18915) | - | 3639819..3640046 (-) | 228 | WP_000737398.1 | KH domain-containing protein | - |
| KM392_RS18915 (KM392_18920) | rpsP | 3640061..3640333 (-) | 273 | WP_000268750.1 | 30S ribosomal protein S16 | - |
| KM392_RS18920 (KM392_18925) | ffh | 3640434..3641783 (-) | 1350 | WP_000863456.1 | signal recognition particle protein | - |
| KM392_RS18925 (KM392_18930) | - | 3641796..3642128 (-) | 333 | WP_000891062.1 | putative DNA-binding protein | - |
| KM392_RS18930 (KM392_18935) | ftsY | 3642262..3643251 (-) | 990 | WP_000007650.1 | signal recognition particle-docking protein FtsY | - |
| KM392_RS18935 (KM392_18940) | smc | 3643267..3646836 (-) | 3570 | WP_000478986.1 | chromosome segregation protein SMC | - |
| KM392_RS18940 (KM392_18945) | rncS | 3646983..3647720 (-) | 738 | WP_001146873.1 | ribonuclease III | - |
| KM392_RS18945 (KM392_18950) | acpP | 3647779..3648012 (-) | 234 | WP_000786062.1 | acyl carrier protein | - |
| KM392_RS18950 (KM392_18955) | fabG | 3648082..3648822 (-) | 741 | WP_000911782.1 | 3-oxoacyl-[acyl-carrier-protein] reductase | - |
| KM392_RS18955 (KM392_18960) | fabD | 3648822..3649766 (-) | 945 | WP_000516948.1 | ACP S-malonyltransferase | - |
| KM392_RS18960 (KM392_18965) | plsX | 3649781..3650773 (-) | 993 | WP_000684111.1 | phosphate acyltransferase PlsX | - |
| KM392_RS18965 (KM392_18970) | fapR | 3650770..3651363 (-) | 594 | WP_000747352.1 | transcription factor FapR | - |
| KM392_RS18970 (KM392_18975) | recG | 3651452..3653500 (-) | 2049 | WP_001006884.1 | ATP-dependent DNA helicase RecG | - |
| KM392_RS18975 (KM392_18980) | - | 3653790..3655466 (-) | 1677 | WP_000027136.1 | DAK2 domain-containing protein | - |
| KM392_RS18980 (KM392_18985) | - | 3655489..3655851 (-) | 363 | WP_000021109.1 | Asp23/Gls24 family envelope stress response protein | - |
| KM392_RS18985 (KM392_18990) | rpmB | 3656230..3656418 (+) | 189 | WP_000124778.1 | 50S ribosomal protein L28 | - |
| KM392_RS18990 (KM392_18995) | spoVM | 3656492..3656572 (-) | 81 | WP_001213599.1 | stage V sporulation protein SpoVM | - |
| KM392_RS18995 (KM392_19000) | - | 3656639..3657319 (-) | 681 | WP_025388434.1 | thiamine diphosphokinase | - |
| KM392_RS19000 (KM392_19005) | rpe | 3657419..3658063 (-) | 645 | WP_000589966.1 | ribulose-phosphate 3-epimerase | - |
| KM392_RS19005 (KM392_19010) | rsgA | 3658066..3658947 (-) | 882 | WP_001113935.1 | ribosome small subunit-dependent GTPase A | - |
| KM392_RS19010 (KM392_19015) | prkC | 3659216..3661189 (-) | 1974 | WP_000904759.1 | serine/threonine protein kinase PrkC | - |
| KM392_RS19015 (KM392_19020) | - | 3661198..3661950 (-) | 753 | WP_000648699.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| KM392_RS19020 (KM392_19025) | rlmN | 3661955..3663043 (-) | 1089 | WP_000450543.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| KM392_RS19025 (KM392_19030) | rsmB | 3663048..3664382 (-) | 1335 | WP_001249680.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
Sequence
Protein
Download Length: 96 a.a. Molecular weight: 10600.29 Da Isoelectric Point: 9.7220
>NTDB_id=573736 KM392_RS28770 WP_324254321.1 3632335..3632625(-) (dprA) [Bacillus anthracis strain AF039]
MYIVINRVSSALCTKKWYFPKRNRIISGISKGVLVVEAKSRSGTLITADLALEQNREVFALPGPIFTDSASGTNHLIQQG
AKLVRNAEDILEEILN
MYIVINRVSSALCTKKWYFPKRNRIISGISKGVLVVEAKSRSGTLITADLALEQNREVFALPGPIFTDSASGTNHLIQQG
AKLVRNAEDILEEILN
Nucleotide
Download Length: 291 bp
>NTDB_id=573736 KM392_RS28770 WP_324254321.1 3632335..3632625(-) (dprA) [Bacillus anthracis strain AF039]
ATATATATTGTTATTAACAGAGTATCCTCCGCACTATGCACCAAAAAATGGTATTTTCCAAAAAGGAATCGAATTATTAG
TGGTATAAGTAAAGGTGTTTTAGTTGTAGAAGCGAAATCGAGAAGCGGAACACTTATTACTGCAGACCTTGCTCTAGAGC
AAAATAGAGAGGTATTTGCACTTCCTGGACCTATATTTACAGATAGTGCATCAGGAACAAATCATCTTATTCAACAAGGA
GCGAAACTAGTAAGAAATGCAGAAGATATACTAGAAGAGATTTTAAATTAA
ATATATATTGTTATTAACAGAGTATCCTCCGCACTATGCACCAAAAAATGGTATTTTCCAAAAAGGAATCGAATTATTAG
TGGTATAAGTAAAGGTGTTTTAGTTGTAGAAGCGAAATCGAGAAGCGGAACACTTATTACTGCAGACCTTGCTCTAGAGC
AAAATAGAGAGGTATTTGCACTTCCTGGACCTATATTTACAGATAGTGCATCAGGAACAAATCATCTTATTCAACAAGGA
GCGAAACTAGTAAGAAATGCAGAAGATATACTAGAAGAGATTTTAAATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.