Detailed information
Overview
| Name | dprA/cilB/dalA | Type | Machinery gene |
| Locus tag | SPD_RS05990 | Genome accession | NC_008533 |
| Coordinates | 1153426..1154274 (-) | Length | 282 a.a. |
| NCBI ID | WP_000705306.1 | Uniprot ID | Q8DPI7 |
| Organism | Streptococcus pneumoniae D39 | ||
| Function | ssDNA binding; loading RecA onto ssDNA; competence shut-off DNA processing Competence regulation |
||
Function
In S. pneumoniae, it was found that DprA plays a dual role. First, DprA (DNA Processing Protein A) is essential for protecting internalized single-stranded DNA (ssDNA) and facilitating its loading onto RecA recombinase during natural transformation. Second, DprA also mediates competence shut-off by dissociating ComE∼P dimers from the promoters of the early competence genes.
Genomic Context
Location: 1148426..1159274
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPD_RS05970 (SPD_1119) | - | 1148774..1149133 (-) | 360 | WP_001237219.1 | YbaN family protein | - |
| SPD_RS05975 (SPD_1120) | topA | 1149239..1151326 (-) | 2088 | WP_000179646.1 | type I DNA topoisomerase | - |
| SPD_RS05980 (SPD_1121) | - | 1151493..1152536 (-) | 1044 | WP_001812710.1 | TIGR00341 family protein | - |
| SPD_RS11915 | - | 1153120..1153242 (+) | 123 | WP_001814242.1 | hypothetical protein | - |
| SPD_RS05990 (SPD_1122) | dprA/cilB/dalA | 1153426..1154274 (-) | 849 | WP_000705306.1 | DNA-processing protein DprA | Machinery gene |
| SPD_RS05995 (SPD_1123) | - | 1154370..1155059 (-) | 690 | WP_000643970.1 | sugar phosphate nucleotidyltransferase | - |
| SPD_RS06000 (SPD_1124) | - | 1155071..1155949 (-) | 879 | WP_000837617.1 | DMT family transporter | - |
| SPD_RS06005 (SPD_1125) | licA | 1155939..1156808 (-) | 870 | WP_000411210.1 | choline kinase LicA | - |
| SPD_RS06010 (SPD_1126) | - | 1156825..1157847 (-) | 1023 | WP_000609885.1 | ribitol-5-phosphate dehydrogenase | - |
| SPD_RS06015 (SPD_1127) | - | 1157852..1158559 (-) | 708 | WP_000638508.1 | IspD/TarI family cytidylyltransferase | - |
Sequence
Protein
Download Length: 282 a.a. Molecular weight: 31062.72 Da Isoelectric Point: 5.4047
MKITNYEIYKLKKSGLTNQQILKVLEYGENVDQELLLGDIADISGCRNPAVFMERYFQIDDAHLSKEFQKFPSFSILDDC
YPWDLSEIYDAPVLLFYKGNLDLLKFPKVAVVGSRACSKQGAKSVEKVIQGLENELVIVSGLAKGIDTAAHMAALQNGGK
TIAVIGTGLDVFYPKANKRLQDYIGNDHLVLSEYGPGEQPLKFHFPARNRIIAGLCRGVIVAEAKMRSGSLITCERAMEE
GRDVFAIPGSILDGLSDGCHHLIQEGAKLVTSGQDVLAEFEF
Nucleotide
Download Length: 849 bp
ATGAAAATCACAAACTATGAAATCTATAAGTTAAAAAAATCAGGTTTGACCAATCAACAGATTTTGAAAGTTCTAGAATA
CGGTGAAAATGTTGATCAGGAGCTTTTGTTGGGTGATATTGCAGATATATCAGGTTGCCGTAATCCAGCCGTTTTTATGG
AACGTTATTTTCAGATAGACGATGCGCATTTGTCGAAAGAGTTTCAAAAATTTCCATCTTTCTCTATTTTAGATGACTGT
TATCCTTGGGATTTGAGTGAAATATATGATGCGCCTGTACTTTTATTTTACAAGGGAAATCTTGACCTCCTGAAATTCCC
GAAGGTAGCGGTCGTGGGCAGTCGTGCTTGTAGCAAACAGGGAGCTAAATCAGTTGAAAAAGTCATTCAAGGCTTGGAAA
ATGAACTGGTTATTGTCAGTGGTCTGGCCAAGGGCATTGACACAGCAGCTCATATGGCAGCTCTTCAGAATGGCGGAAAA
ACCATTGCAGTGATTGGAACAGGACTGGATGTGTTTTATCCTAAAGCCAATAAACGCTTGCAAGACTACATCGGCAATGA
CCATCTGGTTCTAAGTGAATATGGACCTGGCGAACAACCTCTGAAATTTCATTTTCCTGCCCGTAATCGCATCATTGCTG
GACTTTGTCGTGGTGTGATTGTAGCAGAGGCTAAGATGCGTTCAGGTAGTCTCATTACGTGTGAGCGAGCAATGGAAGAA
GGACGCGATGTCTTTGCTATTCCTGGTAGCATTTTAGATGGACTATCAGACGGTTGCCATCATTTGATTCAAGAAGGAGC
AAAATTGGTCACCAGTGGGCAAGATGTTCTTGCGGAATTTGAATTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| dprA/cilB/dalA | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| dprA/cilB/dalA | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| dprA/cilB/dalA | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| dprA/cilB/dalA | Streptococcus mitis NCTC 12261 |
98.582 |
100 |
0.986 |
| dprA/cilB/dalA | Streptococcus mitis SK321 |
97.872 |
100 |
0.979 |
| dprA | Streptococcus mutans UA159 |
63.214 |
100 |
0.632 |
| dprA | Lactococcus lactis subsp. cremoris KW2 |
55.714 |
99.291 |
0.553 |
| dprA | Staphylococcus aureus N315 |
37.809 |
100 |
0.379 |
| dprA | Haemophilus influenzae Rd KW20 |
38.202 |
94.681 |
0.362 |
Multiple sequence alignment
References
| [1] | Jingjun Lin et al. (2020) Streptococcus pneumoniae Elaborates Persistent and Prolonged Competent State during Pneumonia-Derived Sepsis. Infection And Immunity 88(4):e00919-19. [PMID: 31988172] |
| [2] | Calum Hg Johnston et al. (2020) The alternative sigma factor σX mediates competence shut-off at the cell pole in Streptococcus pneumoniae. ELife 9:e62907. [PMID: 33135635] |
| [3] | Jingjun Lin et al. (2019) DprA-Dependent Exit from the Competent State Regulates Multifaceted Streptococcus pneumoniae Virulence. Infection And Immunity 87(11):e00349-19. [PMID: 31451619] |
| [4] | Calum Johnston et al. (2018) Fine-tuning cellular levels of DprA ensures transformant fitness in the human pathogen Streptococcus pneumoniae. Molecular Microbiology 109(5):663-675. [PMID: 29995987] |
| [5] | Mathias Weyder et al. (2018) Dynamic Modeling of Streptococcus pneumoniae Competence Provides Regulatory Mechanistic Insights Into Its Tight Temporal Regulation. Frontiers in Microbiology 9:1637. [PMID: 30087661] |
| [6] | Yi Yu et al. (2017) The virulence of Streptococcus pneumoniae partially depends on dprA. Brazilian Journal of Microbiology : [publication of The Brazilian Society For Microbiology] 48(2):225-231. [PMID: 28011228] |
| [7] | Amy Diallo et al. (2017) Bacterial transformation: ComFA is a DNA-dependent ATPase that forms complexes with ComFC and DprA. Molecular Microbiology 105(5):741-754. [PMID: 28618091] |
| [8] | Johnny Lisboa et al. (2014) Molecular determinants of the DprA-RecA interaction for nucleation on ssDNA. Nucleic Acids Research 42(11):7395-408. [PMID: 24782530] |
| [9] | Nicolas Mirouze et al. (2013) Direct involvement of DprA, the transformation-dedicated RecA loader, in the shut-off of pneumococcal competence. Proceedings of The National Academy of Sciences of The United States of America 110(11):E1035-44. [PMID: 23440217] |
| [10] | Liming Weng et al. (2013) Exit from competence for genetic transformation in Streptococcus pneumoniae is regulated at multiple levels. PloS One 8(5):e64197. [PMID: 23717566] |
| [11] | Sophie Quevillon-Cheruel et al. (2012) Structure-function analysis of pneumococcal DprA protein reveals that dimerization is crucial for loading RecA recombinase onto DNA during transformation. Proceedings of The National Academy of Sciences of The United States of America 109(37):E2466-75. [PMID: 22904190] |
| [12] | Isabelle Mortier-Barrière et al. (2007) A key presynaptic role in transformation for a widespread bacterial protein: DprA conveys incoming ssDNA to RecA. Cell 130(5):824-36. [PMID: 17803906] |
| [13] | Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980] |
| [14] | Mathieu Bergé et al. (2003) Transformation of Streptococcus pneumoniae relies on DprA- and RecA-dependent protection of incoming DNA single strands. Molecular Microbiology 50(2):527-36. [PMID: 14617176] |