Detailed information
Bioinformatically predicted
Overview
| Name | Cj0011c | Type | Machinery gene |
| Locus tag | A0073_RS00325 | Genome accession | NZ_CP037747 |
| Coordinates | 48113..48352 (+) | Length | 79 a.a. |
| NCBI ID | WP_082200224.1 | Uniprot ID | A0AAX2UJ31 |
| Organism | Campylobacter helveticus strain 2013D-9613 | ||
| Function | DNA binding (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 8647..57254 | 48113..48352 | within | 0 |
Gene organization within MGE regions
Location: 8647..57254
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A0073_RS00050 (A0073_00050) | - | 8779..9531 (+) | 753 | WP_131935977.1 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| A0073_RS00055 (A0073_00055) | - | 9518..10726 (+) | 1209 | WP_131935979.1 | toprim domain-containing protein | - |
| A0073_RS00060 (A0073_00060) | - | 11825..12619 (-) | 795 | WP_252972808.1 | BRO family protein | - |
| A0073_RS10240 | - | 12680..12847 (-) | 168 | WP_252972809.1 | hypothetical protein | - |
| A0073_RS00065 (A0073_00065) | - | 12837..13142 (-) | 306 | WP_131935983.1 | hypothetical protein | - |
| A0073_RS00070 (A0073_00070) | - | 13174..13386 (-) | 213 | WP_131935985.1 | hypothetical protein | - |
| A0073_RS00075 (A0073_00075) | - | 13380..13571 (-) | 192 | WP_131935987.1 | hypothetical protein | - |
| A0073_RS10245 | - | 13568..13741 (-) | 174 | WP_171050543.1 | hypothetical protein | - |
| A0073_RS00080 (A0073_00080) | - | 13738..13917 (-) | 180 | WP_131935989.1 | hypothetical protein | - |
| A0073_RS00085 (A0073_00085) | - | 13901..14278 (-) | 378 | WP_131935991.1 | hypothetical protein | - |
| A0073_RS00090 (A0073_00090) | - | 14317..14535 (-) | 219 | WP_131935993.1 | hypothetical protein | - |
| A0073_RS10250 | - | 14508..14663 (-) | 156 | WP_252972810.1 | hypothetical protein | - |
| A0073_RS00095 (A0073_00095) | - | 14766..15242 (-) | 477 | WP_131935995.1 | hypothetical protein | - |
| A0073_RS00100 (A0073_00100) | - | 15280..15816 (-) | 537 | WP_131935997.1 | hypothetical protein | - |
| A0073_RS00105 (A0073_00105) | - | 15865..16056 (-) | 192 | WP_131935999.1 | hypothetical protein | - |
| A0073_RS00110 (A0073_00110) | - | 16070..16432 (-) | 363 | WP_131936001.1 | hypothetical protein | - |
| A0073_RS00115 (A0073_00115) | - | 16434..16703 (-) | 270 | WP_131936003.1 | hypothetical protein | - |
| A0073_RS00120 (A0073_00120) | - | 16700..17032 (-) | 333 | WP_131936005.1 | hypothetical protein | - |
| A0073_RS00125 (A0073_00125) | - | 17082..17762 (-) | 681 | WP_131936007.1 | hypothetical protein | - |
| A0073_RS00130 (A0073_00130) | - | 17903..18496 (-) | 594 | WP_131936009.1 | hypothetical protein | - |
| A0073_RS00135 (A0073_00135) | - | 18722..19135 (+) | 414 | WP_131936011.1 | hypothetical protein | - |
| A0073_RS00140 (A0073_00140) | - | 19174..19422 (-) | 249 | WP_131936013.1 | hypothetical protein | - |
| A0073_RS00145 (A0073_00145) | - | 19641..20228 (-) | 588 | WP_131936015.1 | thermonuclease family protein | - |
| A0073_RS00150 (A0073_00150) | - | 20231..20740 (-) | 510 | WP_131936017.1 | hypothetical protein | - |
| A0073_RS10255 | - | 20979..21122 (-) | 144 | WP_213272632.1 | hypothetical protein | - |
| A0073_RS00155 (A0073_00155) | - | 21119..21679 (-) | 561 | WP_131936019.1 | YopX family protein | - |
| A0073_RS00160 (A0073_00160) | - | 21660..21983 (-) | 324 | WP_131936021.1 | hypothetical protein | - |
| A0073_RS00165 (A0073_00165) | - | 21998..22360 (-) | 363 | WP_131936023.1 | YopX family protein | - |
| A0073_RS00170 (A0073_00170) | - | 22357..22731 (-) | 375 | WP_131936025.1 | hypothetical protein | - |
| A0073_RS00175 (A0073_00175) | - | 22743..23090 (-) | 348 | WP_131936027.1 | hypothetical protein | - |
| A0073_RS00180 (A0073_00180) | - | 23087..23623 (-) | 537 | WP_131936029.1 | hypothetical protein | - |
| A0073_RS00185 (A0073_00185) | - | 23687..24130 (-) | 444 | WP_131936031.1 | single-stranded DNA-binding protein | - |
| A0073_RS00190 (A0073_00190) | - | 24239..26302 (-) | 2064 | WP_131936033.1 | type IA DNA topoisomerase | - |
| A0073_RS00195 (A0073_00195) | - | 26453..27670 (-) | 1218 | WP_131936035.1 | type IV secretion system protein | - |
| A0073_RS00200 (A0073_00200) | - | 27684..27959 (-) | 276 | WP_131936037.1 | hypothetical protein | - |
| A0073_RS00205 (A0073_00205) | - | 28241..29062 (-) | 822 | WP_131936039.1 | ArdC family protein | - |
| A0073_RS00210 (A0073_00210) | - | 29110..29298 (-) | 189 | WP_131936041.1 | hypothetical protein | - |
| A0073_RS00215 (A0073_00215) | - | 29536..31521 (-) | 1986 | WP_131936042.1 | type IV secretory system conjugative DNA transfer family protein | - |
| A0073_RS00220 (A0073_00220) | - | 31514..32041 (-) | 528 | WP_131936044.1 | hypothetical protein | - |
| A0073_RS00225 (A0073_00225) | - | 32041..33045 (-) | 1005 | WP_131937811.1 | ATPase, T2SS/T4P/T4SS family | - |
| A0073_RS00230 (A0073_00230) | - | 33078..33365 (-) | 288 | WP_131936046.1 | hypothetical protein | - |
| A0073_RS00235 (A0073_00235) | - | 33398..34639 (-) | 1242 | WP_131936048.1 | DNA type IV secretion system protein ComB10 | - |
| A0073_RS00240 (A0073_00240) | - | 34639..35802 (-) | 1164 | WP_131936050.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| A0073_RS00245 (A0073_00245) | - | 35799..36470 (-) | 672 | WP_131936052.1 | VirB8/TrbF family protein | - |
| A0073_RS10835 | - | 36472..36603 (-) | 132 | WP_255298159.1 | hypothetical protein | - |
| A0073_RS00250 (A0073_00250) | - | 36600..39224 (-) | 2625 | WP_131936054.1 | type IV secretion system DNA-binding domain-containing protein | - |
| A0073_RS00255 (A0073_00255) | - | 39269..39511 (-) | 243 | WP_131936056.1 | hypothetical protein | - |
| A0073_RS00260 (A0073_00260) | - | 39555..39857 (-) | 303 | WP_131936058.1 | hypothetical protein | - |
| A0073_RS00265 (A0073_00265) | - | 40709..42388 (+) | 1680 | WP_082199068.1 | hypothetical protein | - |
| A0073_RS00270 (A0073_00270) | - | 42399..42590 (-) | 192 | WP_082199067.1 | adenine-specific methyltransferase EcoRI family protein | - |
| A0073_RS00275 (A0073_00275) | - | 42591..43553 (-) | 963 | WP_082199066.1 | RelA/SpoT domain-containing protein | - |
| A0073_RS00280 (A0073_00280) | - | 43562..43819 (-) | 258 | WP_082199065.1 | hypothetical protein | - |
| A0073_RS00285 (A0073_00285) | - | 43841..44041 (-) | 201 | WP_082199064.1 | type II toxin-antitoxin system HicA family toxin | - |
| A0073_RS00290 (A0073_00290) | - | 44034..44273 (-) | 240 | WP_082199063.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| A0073_RS00295 (A0073_00295) | - | 44304..44582 (-) | 279 | WP_082199062.1 | type II toxin-antitoxin system YafQ family toxin | - |
| A0073_RS00300 (A0073_00300) | - | 44575..44841 (-) | 267 | WP_082199061.1 | hypothetical protein | - |
| A0073_RS00305 (A0073_00305) | - | 44998..45621 (-) | 624 | WP_082199060.1 | ParA family protein | - |
| A0073_RS00310 (A0073_00310) | - | 45742..46311 (+) | 570 | WP_131936060.1 | hypothetical protein | - |
| A0073_RS00315 (A0073_00315) | - | 46324..46677 (+) | 354 | WP_131936062.1 | hypothetical protein | - |
| A0073_RS00320 (A0073_00320) | - | 46705..47904 (+) | 1200 | WP_131936064.1 | site-specific integrase | - |
| A0073_RS00325 (A0073_00325) | Cj0011c | 48113..48352 (+) | 240 | WP_082200224.1 | DUF655 domain-containing protein | Machinery gene |
| A0073_RS00330 (A0073_00330) | - | 48401..51409 (-) | 3009 | WP_131936066.1 | efflux RND transporter permease subunit | - |
| A0073_RS00335 (A0073_00335) | - | 51411..52154 (-) | 744 | WP_082200222.1 | efflux RND transporter periplasmic adaptor subunit | - |
| A0073_RS00340 (A0073_00340) | - | 52151..53416 (-) | 1266 | WP_131936068.1 | TolC family protein | - |
| A0073_RS00345 (A0073_00345) | - | 53469..54161 (+) | 693 | WP_082200220.1 | NAD-dependent deacetylase | - |
| A0073_RS00350 (A0073_00350) | - | 54154..54753 (+) | 600 | WP_082200219.1 | LysE family transporter | - |
| A0073_RS00355 (A0073_00355) | dapE | 54756..55853 (+) | 1098 | WP_131936070.1 | succinyl-diaminopimelate desuccinylase | - |
Sequence
Protein
Download Length: 79 a.a. Molecular weight: 8826.39 Da Isoelectric Point: 8.5317
>NTDB_id=349872 A0073_RS00325 WP_082200224.1 48113..48352(+) (Cj0011c) [Campylobacter helveticus strain 2013D-9613]
MKKIVFLMFALASFLFAAVNLNTATLEELKSLKGIGATKAQAILDYRKEQNFTSIEELKKVKGIGDKTFEEIKDSIVVE
MKKIVFLMFALASFLFAAVNLNTATLEELKSLKGIGATKAQAILDYRKEQNFTSIEELKKVKGIGDKTFEEIKDSIVVE
Nucleotide
Download Length: 240 bp
>NTDB_id=349872 A0073_RS00325 WP_082200224.1 48113..48352(+) (Cj0011c) [Campylobacter helveticus strain 2013D-9613]
ATGAAGAAAATAGTTTTCTTAATGTTTGCTTTGGCGAGTTTCTTATTTGCTGCGGTCAATTTAAATACCGCTACACTTGA
AGAGTTGAAAAGTCTAAAAGGTATAGGAGCAACTAAGGCTCAAGCGATTTTAGATTATAGAAAAGAGCAAAATTTCACAA
GCATAGAGGAACTTAAAAAAGTTAAGGGTATCGGTGATAAAACCTTTGAAGAGATAAAAGATTCGATTGTTGTGGAATAG
ATGAAGAAAATAGTTTTCTTAATGTTTGCTTTGGCGAGTTTCTTATTTGCTGCGGTCAATTTAAATACCGCTACACTTGA
AGAGTTGAAAAGTCTAAAAGGTATAGGAGCAACTAAGGCTCAAGCGATTTTAGATTATAGAAAAGAGCAAAATTTCACAA
GCATAGAGGAACTTAAAAAAGTTAAGGGTATCGGTGATAAAACCTTTGAAGAGATAAAAGATTCGATTGTTGTGGAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.