Detailed information NTG0156060

Bioinformatically predicted

Overview

• Name: comR/comR2
• Type: Regulator
• Locus tag: RN86_RS03130
• Genome accession: NZ_CP012648
• Coordinates: 664332..664814 (+)
• Length: 160 a.a.
• NCBI ID: WP_045772576.1
• Uniprot ID: A0A0F3HQT1
• Organism: Streptococcus gordonii strain KCOM 1506 (= ChDC B679)
• Function: activate transcription of late competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	647856..673926	664332..664814	within	0

Gene organization within MGE regions

Location: 647856..673926

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RN86_RS03030 (RN86_03025)	htrA	647856..649049 (-)	1194	WP_045504979.1	S1C family serine protease	Regulator
RN86_RS03035 (RN86_03030)	rlmH	649243..649722 (+)	480	WP_008808034.1	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	-
RN86_RS11220	comC/comC1	650008..650172 (+)	165	WP_080998577.1	bacteriocin	Regulator
RN86_RS03050 (RN86_03045)	comD/comD2	650185..651546 (+)	1362	WP_052721528.1	competence system sensor histidine kinase ComD	Regulator
RN86_RS03055 (RN86_03050)	comE/comE2	651543..652310 (+)	768	WP_008808031.1	competence system response regulator transcription factor ComE	Regulator
RN86_RS03070 (RN86_03065)	ychF	652632..653747 (+)	1116	WP_008808030.1	redox-regulated ATPase YchF	-
RN86_RS03075 (RN86_03070)	pth	653821..654390 (+)	570	WP_046164770.1	aminoacyl-tRNA hydrolase	-
RN86_RS03080 (RN86_03075)	mfd	654383..657886 (+)	3504	WP_155465098.1	transcription-repair coupling factor	-
RN86_RS03085 (RN86_03080)	-	657952..658218 (+)	267	WP_012131074.1	RNA-binding S4 domain-containing protein	-
RN86_RS03090 (RN86_03085)	-	658211..658579 (+)	369	WP_008808026.1	septum formation initiator family protein	-
RN86_RS11595 (RN86_03090)	-	658582..658701 (+)	120	WP_037622626.1	SP_0009 family protein	-
RN86_RS03100 (RN86_03095)	-	658701..659981 (+)	1281	WP_046164769.1	serine hydrolase	-
RN86_RS03105 (RN86_03100)	tilS	659978..661255 (+)	1278	WP_053794274.1	tRNA lysidine(34) synthetase TilS	-
RN86_RS03110 (RN86_03105)	hpt	661260..661802 (+)	543	WP_046164767.1	hypoxanthine phosphoribosyltransferase	-
RN86_RS03115 (RN86_03110)	ftsH	661821..663803 (+)	1983	WP_053794275.1	ATP-dependent zinc metalloprotease FtsH	-
RN86_RS03130 (RN86_03125)	comR/comR2	664332..664814 (+)	483	WP_045772576.1	sigma-70 family RNA polymerase sigma factor	Regulator
RN86_RS03290 (RN86_03285)	mreC	672609..673424 (+)	816	WP_053794276.1	rod shape-determining protein MreC	-
RN86_RS03295 (RN86_03290)	mreD	673426..673926 (+)	501	WP_046164571.1	rod shape-determining protein MreD	-

Sequence

Protein

• Length: 160 a.a.
• Molecular weight: 19931.87 Da
• Isoelectric Point: 9.4703

>NTDB_id=156060 RN86_RS03130 WP_045772576.1 664332..664814(+) (comR/comR2) [Streptococcus gordonii strain KCOM 1506 (= ChDC B679)]
MKFEDVYKQVEGIVKRCYKDYYLHLWEYADWRQEGMLVLYELLKSHPNLLEDHPRLYRYFKTKFRNRIHDLIRRQESQKR
KLDRQPYEEVSEIGHRLRMKELYLDELVAFRSAMAEYRSQLSPEESKQYERLMADERFKGRKAMLKDLSYHLRDFNPRLD

Nucleotide

• Length: 483 bp

>NTDB_id=156060 RN86_RS03130 WP_045772576.1 664332..664814(+) (comR/comR2) [Streptococcus gordonii strain KCOM 1506 (= ChDC B679)]
ATGAAGTTTGAGGACGTATACAAACAAGTTGAAGGGATAGTCAAGCGCTGTTATAAAGATTATTATCTGCACTTATGGGA
GTATGCAGATTGGAGGCAGGAAGGAATGTTGGTGTTGTACGAATTATTAAAAAGTCATCCCAACCTACTGGAAGATCATC
CACGCCTGTACCGTTACTTTAAGACCAAGTTTCGGAACAGAATTCATGATTTGATTCGTCGCCAAGAGAGTCAAAAGCGG
AAATTGGACAGGCAACCCTATGAAGAGGTCAGCGAGATAGGTCATCGTTTAAGAATGAAAGAGCTGTATCTGGATGAATT
GGTAGCCTTTAGAAGTGCAATGGCAGAGTATAGAAGTCAGCTCAGTCCAGAAGAATCAAAACAATATGAGCGTCTGATGG
CAGATGAAAGGTTCAAAGGACGTAAGGCAATGCTCAAAGATCTGTCCTATCACTTAAGGGATTTCAATCCCCGTTTAGAT
TAA

Domains

No domain identified.

3D structure

• AlphaFold DB: A0A0F3HQT1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	97.5	100	0.975
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	97.5	100	0.975
comX/sigX/comX1/sigX1	Streptococcus mitis SK321	50	97.5	0.488
comX/sigX/comX2/sigX2	Streptococcus mitis NCTC 12261	49.359	97.5	0.481
comX/sigX/comX2/sigX2	Streptococcus mitis SK321	49.359	97.5	0.481
comX/comX1	Streptococcus pneumoniae Rx1	48.718	97.5	0.475
comX/comX2	Streptococcus pneumoniae D39	48.718	97.5	0.475
comX/comX1	Streptococcus pneumoniae D39	48.718	97.5	0.475
comX/comX2	Streptococcus pneumoniae R6	48.718	97.5	0.475
comX/comX1	Streptococcus pneumoniae R6	48.718	97.5	0.475
comX/comX1	Streptococcus pneumoniae TIGR4	48.718	97.5	0.475
comX/comX2	Streptococcus pneumoniae Rx1	48.718	97.5	0.475
comX/comX2	Streptococcus pneumoniae TIGR4	48.718	97.5	0.475
comX/sigX/comX1/sigX1	Streptococcus mitis NCTC 12261	48.077	97.5	0.469
comX/sigX	Streptococcus suis P1/7	48.387	96.875	0.469
comX/sigX	Streptococcus suis D9	48.387	96.875	0.469
comX/sigX	Streptococcus suis isolate S10	48.387	96.875	0.469
comX/sigX	Streptococcus mutans UA159	47.436	97.5	0.463
comX	Streptococcus thermophilus LMG 18311	43.871	96.875	0.425
comX	Streptococcus thermophilus LMD-9	43.871	96.875	0.425
comX/sigX	Streptococcus salivarius strain HSISS4	43.226	96.875	0.419
comX	Streptococcus salivarius SK126	43.226	96.875	0.419
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	42.208	96.25	0.406
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	42.208	96.25	0.406
comX	Streptococcus sobrinus strain NIDR 6715-7	42.208	96.25	0.406
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	40.506	98.75	0.4
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	41.558	96.25	0.4
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	41.558	96.25	0.4
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	41.558	96.25	0.4
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	41.558	96.25	0.4