Detailed information NTG0156115

Bioinformatically predicted

Overview

• Name: comC/comC1
• Type: Regulator
• Locus tag: RN86_RS11220
• Genome accession: NZ_CP012648
• Coordinates: 650008..650172 (+)
• Length: 54 a.a.
• NCBI ID: WP_080998577.1
• Uniprot ID: -
• Organism: Streptococcus gordonii strain KCOM 1506 (= ChDC B679)
• Function: binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	647856..673926	650008..650172	within	0

Gene organization within MGE regions

Location: 647856..673926

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RN86_RS03030 (RN86_03025)	htrA	647856..649049 (-)	1194	WP_045504979.1	S1C family serine protease	Regulator
RN86_RS03035 (RN86_03030)	rlmH	649243..649722 (+)	480	WP_008808034.1	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	-
RN86_RS11220	comC/comC1	650008..650172 (+)	165	WP_080998577.1	bacteriocin	Regulator
RN86_RS03050 (RN86_03045)	comD/comD2	650185..651546 (+)	1362	WP_052721528.1	competence system sensor histidine kinase ComD	Regulator
RN86_RS03055 (RN86_03050)	comE/comE2	651543..652310 (+)	768	WP_008808031.1	competence system response regulator transcription factor ComE	Regulator
RN86_RS03070 (RN86_03065)	ychF	652632..653747 (+)	1116	WP_008808030.1	redox-regulated ATPase YchF	-
RN86_RS03075 (RN86_03070)	pth	653821..654390 (+)	570	WP_046164770.1	aminoacyl-tRNA hydrolase	-
RN86_RS03080 (RN86_03075)	mfd	654383..657886 (+)	3504	WP_155465098.1	transcription-repair coupling factor	-
RN86_RS03085 (RN86_03080)	-	657952..658218 (+)	267	WP_012131074.1	RNA-binding S4 domain-containing protein	-
RN86_RS03090 (RN86_03085)	-	658211..658579 (+)	369	WP_008808026.1	septum formation initiator family protein	-
RN86_RS11595 (RN86_03090)	-	658582..658701 (+)	120	WP_037622626.1	SP_0009 family protein	-
RN86_RS03100 (RN86_03095)	-	658701..659981 (+)	1281	WP_046164769.1	serine hydrolase	-
RN86_RS03105 (RN86_03100)	tilS	659978..661255 (+)	1278	WP_053794274.1	tRNA lysidine(34) synthetase TilS	-
RN86_RS03110 (RN86_03105)	hpt	661260..661802 (+)	543	WP_046164767.1	hypoxanthine phosphoribosyltransferase	-
RN86_RS03115 (RN86_03110)	ftsH	661821..663803 (+)	1983	WP_053794275.1	ATP-dependent zinc metalloprotease FtsH	-
RN86_RS03130 (RN86_03125)	comR/comR2	664332..664814 (+)	483	WP_045772576.1	sigma-70 family RNA polymerase sigma factor	Regulator
RN86_RS03290 (RN86_03285)	mreC	672609..673424 (+)	816	WP_053794276.1	rod shape-determining protein MreC	-
RN86_RS03295 (RN86_03290)	mreD	673426..673926 (+)	501	WP_046164571.1	rod shape-determining protein MreD	-

Sequence

Protein

• Length: 54 a.a.
• Molecular weight: 6369.44 Da
• Isoelectric Point: 11.2504

>NTDB_id=156115 RN86_RS11220 WP_080998577.1 650008..650172(+) (comC/comC1) [Streptococcus gordonii strain KCOM 1506 (= ChDC B679)]
MKKKNKQNLLPKELQQFEILTDNKLQTVIGGSQKGVYASQRSFVPSWFRKIFRN

Nucleotide

• Length: 165 bp

>NTDB_id=156115 RN86_RS11220 WP_080998577.1 650008..650172(+) (comC/comC1) [Streptococcus gordonii strain KCOM 1506 (= ChDC B679)]
ATGAAAAAGAAAAACAAACAAAATCTATTGCCAAAAGAGTTACAACAATTTGAAATTTTGACAGATAATAAACTTCAAAC
AGTCATTGGGGGATCTCAAAAAGGTGTTTATGCCAGTCAGAGATCATTTGTTCCAAGTTGGTTCCGTAAAATTTTTAGAA
ATTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comC/comC1	Streptococcus gordonii str. Challis substr. CH1	55.556	100	0.556
comC/comC2	Streptococcus gordonii strain NCTC7865	81.25	59.259	0.481