Detailed information of TA system TA010042

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): mazEF/-
• Location: 1933297..1933879
• Replicon: chromosome
• Accession: NC_010424
• Organism: Candidatus Desulforudis audaxviator MP104C

Toxin (Protein)

• Gene name: mazF
• Uniprot ID: B1I5M6
• Locus tag: DAUD_RS09255
• Protein ID: WP_012302900.1
• Coordinates: 1933297..1933653 (-)
• Length: 119 a.a.

Antitoxin (Protein)

• Gene name: mazE
• Uniprot ID: -
• Locus tag: DAUD_RS09260
• Protein ID: WP_200858705.1
• Coordinates: 1933643..1933879 (-)
• Length: 79 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
DAUD_RS09220 (Daud_1824)	1928930..1929844	-	915	WP_012302896.1	putative DNA binding domain-containing protein	-
DAUD_RS09225 (Daud_1825)	1930023..1930403	-	381	WP_012302897.1	hypothetical protein	-
DAUD_RS09230 (Daud_1826)	1930410..1930583	-	174	Protein_1864	DUF1887 domain-containing protein	-
DAUD_RS09235 (Daud_1827)	1930594..1931487	-	894	WP_166485173.1	CRISPR-associated protein Csx14	-
DAUD_RS09240 (Daud_1828)	1931738..1931947	-	210	WP_041570924.1	4Fe-4S binding protein	-
DAUD_RS12560	1931947..1932126	-	180	WP_166485174.1	hypothetical protein	-
DAUD_RS12565	1932248..1932415	-	168	WP_166485175.1	hypothetical protein	-
DAUD_RS09245 (Daud_1829)	1932412..1932741	-	330	WP_012302899.1	helix-turn-helix domain-containing protein	-
DAUD_RS09250 (Daud_1830)	1932731..1933288	-	558	WP_083756654.1	hypothetical protein	-
DAUD_RS09255 (Daud_1831)	1933297..1933653	-	357	WP_012302900.1	type II toxin-antitoxin system PemK/MazF family toxin	Toxin
DAUD_RS09260 (Daud_1832)	1933643..1933879	-	237	WP_200858705.1	ribbon-helix-helix domain-containing protein	Antitoxin
DAUD_RS09265 (Daud_1833)	1934074..1934550	+	477	WP_012302902.1	hypothetical protein	-
DAUD_RS09270 (Daud_1834)	1934499..1935149	+	651	WP_083756655.1	hypothetical protein	-
DAUD_RS12570	1935484..1935648	-	165	WP_166485176.1	hypothetical protein	-
DAUD_RS09280 (Daud_1835)	1935794..1936735	+	942	WP_012302904.1	hypothetical protein	-
DAUD_RS11685 (Daud_1836)	1936758..1937111	+	354	WP_012302905.1	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	-
DAUD_RS09290 (Daud_1837)	1937108..1937551	+	444	WP_041570926.1	ribonuclease HI	-
DAUD_RS09295 (Daud_1838)	1937636..1937881	-	246	WP_012302907.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• mRNA interferase PemK-like (4-108)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 119 a.a.
• Molecular weight: 12642.52 Da
• Isoelectric Point: 8.9971

>T10042 WP_012302900.1 NC_010424:c1933653-1933297 [Candidatus Desulforudis audaxviator MP104C]
VEIKRGDVFLVNFNPARGSEQAGCRPAVVVQNDVGNKYGPTTIVIAVTTTLKDYPFLVKLSAGEGGLEKDSTANAAQVLT
VDKLRLVRKLGNLTSEKMREINRALAVSLGLTLGETQD

Nucleotide

• Length: 357 bp

>T10042 NC_010424:c1933653-1933297 [Candidatus Desulforudis audaxviator MP104C]
GTGGAGATTAAACGTGGCGATGTTTTCCTGGTGAACTTTAACCCGGCGCGGGGAAGTGAGCAGGCGGGCTGTCGGCCCGC
CGTCGTCGTTCAAAACGATGTGGGCAACAAGTATGGCCCAACCACAATTGTGATCGCAGTGACCACTACTCTCAAGGATT
ACCCCTTCCTGGTGAAGTTAAGCGCTGGAGAAGGGGGACTGGAGAAAGACAGCACGGCCAATGCCGCCCAGGTGTTGACC
GTGGACAAGTTGCGCTTGGTGCGCAAGCTGGGGAATCTCACTTCAGAGAAAATGCGCGAGATAAATCGGGCGCTGGCGGT
GAGCCTTGGGTTGACTCTCGGAGAGACCCAGGATTAA

Antitoxin

Protein

• Length: 79 a.a.
• Molecular weight: 8713.96 Da
• Isoelectric Point: 5.6957

>AT10042 WP_200858705.1 NC_010424:c1933879-1933643 [Candidatus Desulforudis audaxviator MP104C]
VNAKIAVSLPEQLLSVLDSLARKWATTRSGAVAELLRRAEQEELEVRLRQGYLEMAELHKAHAELFLPSQAEVFRGGD

Nucleotide

• Length: 237 bp

>AT10042 NC_010424:c1933879-1933643 [Candidatus Desulforudis audaxviator MP104C]
GTGAACGCGAAAATCGCCGTAAGTTTGCCGGAACAGCTTCTCTCCGTTTTGGATTCCTTGGCCCGGAAATGGGCCACCAC
CAGAAGCGGCGCTGTAGCCGAGCTGCTGCGGCGTGCGGAGCAGGAGGAGCTGGAGGTCCGGCTCAGGCAAGGCTATCTTG
AAATGGCGGAGCTTCACAAAGCCCACGCCGAGCTTTTCCTTCCGTCGCAAGCAGAGGTGTTTCGCGGTGGAGATTAA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T10096	Clostridium difficile R20291	46.429	94.915	0.441
T10094	Staphylococcus aureus strain HG003 isolate RN1 Scaffold_3	46.847	94.068	0.441
T612	Staphylococcus aureus subsp. aureus MW2	46.847	94.068	0.441
T10078	Staphylococcus aureus strain HG003 isolate RN1 Scaffold_3	46.847	94.068	0.441
T10177	Staphylococcus epidermidis isolate BPH0662	46.847	94.068	0.441
T1073	Staphylococcus aureus subsp. aureus N315	46.847	94.068	0.441
T6140	Lactobacillus rhamnosus GG	45.133	95.763	0.432
T6135	Lactobacillus rhamnosus GG	45.133	95.763	0.432
T6136	Lactobacillus rhamnosus Lc 705	45.133	95.763	0.432
T6141	Lactobacillus rhamnosus ATCC 8530	45.133	95.763	0.432
T6090	Staphylococcus equorum	45.946	94.068	0.432
T1499	Bacillus anthracis str. Sterne	42.342	95.69	0.405
T134	Bacillus subtilis subsp. subtilis str. 168	42.342	95.69	0.405
T6252	Mycobacterium tuberculosis H37Rv	37.391	97.458	0.364
T10130	Escherichia coli str. K-12 substr. MC4100 strain K-12	37.736	95.495	0.36
T1044	Escherichia coli str. K-12 substr. MG1655	37.736	95.495	0.36
T655	Leptospira interrogans serovar Lai str. 56601	36.364	97.345	0.354
T6248	Mycobacterium tuberculosis H37Rv	34.746	100	0.347
T10069	Klebsiella pneumoniae subsp. pneumoniae MGH 78578	36.735	87.5	0.321
T10131	Legionella pneumophila subsp. pneumophila str. Lorraine	31.193	100	0.321
T10160	Mycobacterium tuberculosis H37Rv	30.357	100	0.321
T911	Nitrosomonas europaea ATCC 19718	32.432	98.23	0.319
T10140	Pseudomonas savastanoi	30	100	0.308

Multiple sequence alignment

Antitoxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
AT10101	Nitrospira sp. ND1 isolate Nitrospira sp. strain ND1	32.407	99.083	0.321

Multiple sequence alignment

Structures

Toxin

• AlphaFold DB: B1I5M6

References

(1) Hiroko Tamiya-Ishitsuka et al. (2021) Conserved Amino Acid Moieties of Candidatus Desulforudis audaxviator MazF Determine Ribonuclease Activity and Specificity. Frontiers in Microbiology 12:748619. [PubMed:34867867]


 experimental literature