Detailed information of TA system TA001073

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): mazEF/RHH-MazF
• Location: 2121172..2121701
• Replicon: chromosome
• Accession: NC_002745
• Organism: Staphylococcus aureus subsp. aureus N315

Toxin (Protein)

• Gene name: mazF
• Uniprot ID: -
• Locus tag: SA_RS10775
• Protein ID: WP_000621175.1
• Coordinates: 2121172..2121534 (-)
• Length: 121 a.a.

Antitoxin (Protein)

• Gene name: mazE
• Uniprot ID: T1YCG8
• Locus tag: SA_RS10780
• Protein ID: WP_000948331.1
• Coordinates: 2121531..2121701 (-)
• Length: 57 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
SA_RS10750 (SA1869)	2118150..2118920	-	771	WP_001041111.1	RNA polymerase sigma factor SigB	-
SA_RS10755 (SA1870)	2118895..2119374	-	480	WP_001190829.1	anti-sigma B factor RsbW	-
SA_RS10760 (SA1871)	2119376..2119702	-	327	WP_001052491.1	anti-sigma factor antagonist	-
SA_RS10765 (SA1872)	2119821..2120822	-	1002	WP_000390829.1	PP2C family protein-serine/threonine phosphatase	-
SA_RS10775 (SA1873)	2121172..2121534	-	363	WP_000621175.1	type II toxin-antitoxin system PemK/MazF family toxin	Toxin
SA_RS10780 (SAS067)	2121531..2121701	-	171	WP_000948331.1	type II toxin-antitoxin system antitoxin MazE	Antitoxin
SA_RS10785 (SA1874)	2121786..2122934	-	1149	WP_001281154.1	alanine racemase	-
SA_RS10790 (SA1875)	2123000..2123359	-	360	WP_000581197.1	holo-ACP synthase	-
SA_RS10795 (SA1876)	2123363..2123854	-	492	WP_001205912.1	PH domain-containing protein	-
SA_RS10800 (SA1877)	2123841..2125424	-	1584	WP_001294626.1	PH domain-containing protein	-
SA_RS10805 (SA1878)	2125417..2125896	-	480	WP_001287087.1	hypothetical protein	-
SA_RS10810 (SA1879)	2126104..2126664	-	561	WP_001092411.1	K(+)-transporting ATPase subunit C	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• mRNA interferase PemK-like (3-110)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 121 a.a.
• Molecular weight: 13441.69 Da
• Isoelectric Point: 10.1654

>T1073 WP_000621175.1 NC_002745:c2121534-2121172 [Staphylococcus aureus subsp. aureus N315]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Nucleotide

• Length: 363 bp

>T1073 NC_002745:c2121534-2121172 [Staphylococcus aureus subsp. aureus N315]
ATGATTAGACGAGGAGATGTTTATTTAGCAGATTTATCACCAGTACAGGGATCTGAACAAGGGGGAGTCAGACCTGTAGT
CATAATTCAAAATGATACTGGTAATAAATATAGTCCTACAGTTATTGTTGCGGCAATAACTGGTAGGATTAATAAAGCGA
AAATACCGACACATGTAGAGATTGAAAAGAAAAAGTATAAATTGGATAAAGACTCAGTTATATTATTAGAACAAATTCGT
ACACTTGATAAAAAACGATTGAAAGAAAAACTGACGTACTTATCCGATGATAAAATGAAAGAAGTAGATAATGCACTAAT
GATTAGTTTAGGGCTGAATGCAGTAGCTCACCAGAAAAATTAG

Antitoxin

Protein

• Length: 57 a.a.
• Molecular weight: 6251.78 Da
• Isoelectric Point: 3.8305

>AT1073 WP_000948331.1 NC_002745:c2121701-2121531 [Staphylococcus aureus subsp. aureus N315]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Nucleotide

• Length: 171 bp

>AT1073 NC_002745:c2121701-2121531 [Staphylococcus aureus subsp. aureus N315]
ATGTTATCTTTTAGTCAAAATAGAAGTCATAGCTTAGAACAATCTTTAAAAGAAGGATATTCACAAATGGCTGATTTAAA
TCTCTCCCTAGCGAACGAAGCTTTTCCGATAGAGTGTGAAGCATGCGATTGCAACGAAACATATTTATCTTCTAATTCAA
CGAATGAATGA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T10078	Staphylococcus aureus strain HG003 isolate RN1 Scaffold_3	100	100	1
T10094	Staphylococcus aureus strain HG003 isolate RN1 Scaffold_3	100	100	1
T612	Staphylococcus aureus subsp. aureus MW2	100	100	1
T10177	Staphylococcus epidermidis isolate BPH0662	91.667	100	0.917
T6090	Staphylococcus equorum	86.667	100	0.867
T10096	Clostridium difficile R20291	72.973	92.5	0.675
T1499	Bacillus anthracis str. Sterne	69.643	96.552	0.672
T134	Bacillus subtilis subsp. subtilis str. 168	67.857	96.552	0.655
T6135	Lactobacillus rhamnosus GG	63.964	92.5	0.592
T6141	Lactobacillus rhamnosus ATCC 8530	63.964	92.5	0.592
T6136	Lactobacillus rhamnosus Lc 705	63.964	92.5	0.592
T6140	Lactobacillus rhamnosus GG	63.964	92.5	0.592
T10042	Candidatus Desulforudis audaxviator MP104C	46.847	94.068	0.441
T655	Leptospira interrogans serovar Lai str. 56601	43.243	98.23	0.425
T911	Nitrosomonas europaea ATCC 19718	37.5	99.115	0.372
T10131	Legionella pneumophila subsp. pneumophila str. Lorraine	33.333	100	0.349
T6247	Mycobacterium tuberculosis H37Rv	36.449	93.86	0.342
T10160	Mycobacterium tuberculosis H37Rv	28.829	100	0.302

Multiple sequence alignment

Antitoxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
AT10078	Staphylococcus aureus strain HG003 isolate RN1 Scaffold_3	100	100	1
AT10094	Staphylococcus aureus strain HG003 isolate RN1 Scaffold_3	100	100	1
AT612	Staphylococcus aureus subsp. aureus MW2	100	100	1
AT10177	Staphylococcus epidermidis isolate BPH0662	85.714	100	0.857
AT6090	Staphylococcus equorum	78.571	100	0.786
AT10101	Nitrospira sp. ND1 isolate Nitrospira sp. strain ND1	34.694	89.908	0.312

Multiple sequence alignment

Structures

Antitoxin

• AlphaFold DB: A0A0E0VRZ1

References

(1) Ling Zhu et al. (2009) Staphylococcus aureus MazF specifically cleaves a pentad sequence, UACAU, which is unusually abundant in the mRNA for pathogenic adhesive factor SraP. Journal of Bacteriology 191(10):3248-55. [PubMed:19251861]

(2) Niles P Donegan et al. (2010) Proteolytic regulation of toxin-antitoxin systems by ClpPC in Staphylococcus aureus. Journal of Bacteriology 192(5):1416-22. [PubMed:20038589]


 experimental literature