NTDB

Detailed information

Bioinformatically predicted

Overview
Genomic Context
Sequence
Domains
Secondary structure
3D structure
Transmembrane helices
Similar proteins

Overview

Name	comE	Type	Machinery gene
Locus tag	P8T86_RS01610	Genome accession	NZ_CP121102
Coordinates	285332..285490 (+)	Length	52 a.a.
NCBI ID	WP_316576892.1	Uniprot ID	-
Organism	Paenibacillus larvae strain PL006
Function	DNA binding (predicted from homology) DNA binding and uptake

Genomic Context

Location: 280332..290490

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P8T86_RS01600 (P8T86_01580)	leuS	281512..283956 (+)	2445	WP_023483874.1	leucine--tRNA ligase	-
P8T86_RS01605 (P8T86_01585)	comER	283960..284787 (-)	828	WP_036656457.1	late competence protein ComER	-
P8T86_RS01610 (P8T86_01590)	comE	285332..285490 (+)	159	WP_316576892.1	ComEA family DNA-binding protein	Machinery gene
P8T86_RS01615 (P8T86_01595)	-	285589..286881 (+)	1293	WP_036656460.1	homocysteine synthase	-
P8T86_RS01620 (P8T86_01600)	-	286907..287419 (+)	513	WP_023483878.1	deoxycytidylate deaminase	-
P8T86_RS01625 (P8T86_01605)	-	287477..289390 (+)	1914	WP_051428029.1	DNA internalization-related competence protein ComEC/Rec2	-

Sequence

Protein

Download Length: 52 a.a. Molecular weight: 5904.14 Da Isoelectric Point: 10.9585

                                >NTDB_id=810128 P8T86_RS01610 WP_316576892.1 285332..285490(+) (comE) [Paenibacillus larvae strain PL006]

MELPGIGKSKAKAILAYRQQKGTFRSIRELLEVKGIGEKMLAKLIPYMRLNN

Nucleotide

Download Length: 159 bp

                                >NTDB_id=810128 P8T86_RS01610 WP_316576892.1 285332..285490(+) (comE) [Paenibacillus larvae strain PL006]

ATAGAACTTCCCGGAATAGGGAAAAGCAAAGCCAAGGCGATACTGGCATACAGGCAGCAGAAAGGCACTTTTCGTTCTAT

CCGTGAATTGCTTGAGGTAAAGGGAATCGGCGAGAAAATGCTGGCCAAGCTCATCCCTTATATGCGTCTTAATAACTGA

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(2-49)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comE	Neisseria gonorrhoeae MS11	61.905	80.769	0.5
comE	Neisseria gonorrhoeae MS11	61.905	80.769	0.5
comE	Neisseria gonorrhoeae MS11	61.905	80.769	0.5
comE	Neisseria gonorrhoeae MS11	61.905	80.769	0.5
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	54.762	80.769	0.442
comEA	Staphylococcus aureus N315	46	96.154	0.442
comEA	Staphylococcus aureus MW2	46	96.154	0.442
comEA	Acinetobacter baylyi ADP1	52.381	80.769	0.423
comE1/comEA	Haemophilus influenzae Rd KW20	51.22	78.846	0.404
comEA	Acinetobacter baumannii D1279779	50	80.769	0.404
comEA	Legionella pneumophila str. Paris	53.846	75	0.404
comEA	Legionella pneumophila strain ERS1305867	53.846	75	0.404
comEA	Thermus thermophilus HB27	42.857	94.231	0.404
comA	Synechocystis sp. PCC 6803	47.619	80.769	0.385
comEA	Acinetobacter baumannii strain A118	47.619	80.769	0.385
comEA	Bacillus subtilis subsp. subtilis str. 168	47.619	80.769	0.385
comEA	Lactococcus lactis subsp. cremoris KW2	47.619	80.769	0.385
comEA	Vibrio cholerae C6706	51.282	75	0.385
comEA	Vibrio cholerae strain A1552	51.282	75	0.385
comEA	Latilactobacillus sakei subsp. sakei 23K	47.619	80.769	0.385
comEA/comE1	Glaesserella parasuis strain SC1401	48.78	78.846	0.385
comEA	Vibrio campbellii strain DS40M4	46.341	78.846	0.365
comEA	Vibrio parahaemolyticus RIMD 2210633	46.341	78.846	0.365

Detailed information NTG0810128