Detailed information
Overview
| Name | dprA | Type | Machinery gene |
| Locus tag | KM388_RS28745 | Genome accession | NZ_CP076216 |
| Coordinates | 3643250..3643540 (-) | Length | 96 a.a. |
| NCBI ID | WP_324254321.1 | Uniprot ID | - |
| Organism | Bacillus anthracis strain SA020 | ||
| Function | ssDNA binding; loading RecA onto ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 3601530..3675455 | 3643250..3643540 | within | 0 |
Gene organization within MGE regions
Location: 3601530..3675455
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KM388_RS18700 (KM388_18690) | - | 3601873..3603543 (-) | 1671 | WP_000823085.1 | ribonuclease J | - |
| KM388_RS18705 (KM388_18695) | dapA | 3604309..3605187 (-) | 879 | WP_000564767.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| KM388_RS18710 (KM388_18700) | dapG | 3605199..3606431 (-) | 1233 | WP_000692470.1 | aspartate kinase | - |
| KM388_RS18715 (KM388_18705) | asd | 3606455..3607501 (-) | 1047 | WP_000414849.1 | aspartate-semialdehyde dehydrogenase | - |
| KM388_RS18720 (KM388_18710) | dpaB | 3607652..3608251 (-) | 600 | WP_001049484.1 | dipicolinate synthase subunit B | - |
| KM388_RS18725 (KM388_18715) | dpaA | 3608248..3609150 (-) | 903 | WP_000954726.1 | dipicolinic acid synthetase subunit A | - |
| KM388_RS18730 (KM388_18720) | - | 3609425..3609676 (-) | 252 | WP_001239752.1 | YlmC/YmxH family sporulation protein | - |
| KM388_RS18735 (KM388_18725) | - | 3609803..3611044 (-) | 1242 | WP_000592993.1 | pitrilysin family protein | - |
| KM388_RS18740 (KM388_18730) | - | 3611131..3612030 (-) | 900 | WP_000647529.1 | polysaccharide deacetylase family protein | - |
| KM388_RS18745 (KM388_18735) | pnp | 3612182..3614320 (-) | 2139 | WP_000076750.1 | polyribonucleotide nucleotidyltransferase | - |
| KM388_RS18750 (KM388_18740) | rpsO | 3614481..3614750 (-) | 270 | WP_001229392.1 | 30S ribosomal protein S15 | - |
| KM388_RS18755 (KM388_18745) | ribF | 3614851..3615822 (-) | 972 | WP_000766711.1 | bifunctional riboflavin kinase/FAD synthetase | - |
| KM388_RS18760 (KM388_18750) | truB | 3615866..3616789 (-) | 924 | WP_000399357.1 | tRNA pseudouridine(55) synthase TruB | - |
| KM388_RS18765 (KM388_18755) | rbfA | 3616876..3617232 (-) | 357 | WP_000776441.1 | 30S ribosome-binding factor RbfA | - |
| KM388_RS18770 (KM388_18760) | - | 3617248..3617529 (-) | 282 | WP_000582364.1 | DUF503 family protein | - |
| KM388_RS18775 (KM388_18765) | infB | 3617526..3619586 (-) | 2061 | WP_000036340.1 | translation initiation factor IF-2 | - |
| KM388_RS18780 (KM388_18770) | - | 3619591..3619902 (-) | 312 | WP_001286523.1 | YlxQ family RNA-binding protein | - |
| KM388_RS18785 (KM388_18775) | - | 3619903..3620175 (-) | 273 | WP_000071128.1 | YlxR family protein | - |
| KM388_RS18790 (KM388_18780) | nusA | 3620187..3621293 (-) | 1107 | WP_000102606.1 | transcription termination factor NusA | - |
| KM388_RS18795 (KM388_18785) | rimP | 3621311..3621781 (-) | 471 | WP_000359097.1 | ribosome maturation factor RimP | - |
| KM388_RS18800 (KM388_18790) | - | 3622114..3626415 (-) | 4302 | WP_000059983.1 | PolC-type DNA polymerase III | - |
| KM388_RS18805 (KM388_18795) | - | 3626540..3628240 (-) | 1701 | WP_000814312.1 | proline--tRNA ligase | - |
| KM388_RS18810 (KM388_18800) | rseP | 3628350..3629606 (-) | 1257 | WP_001090228.1 | RIP metalloprotease RseP | - |
| KM388_RS18815 (KM388_18805) | dxr | 3629623..3630765 (-) | 1143 | WP_000790359.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| KM388_RS18820 (KM388_18810) | cdsA | 3630789..3631580 (-) | 792 | WP_000813581.1 | phosphatidate cytidylyltransferase | - |
| KM388_RS18825 (KM388_18815) | uppS | 3631598..3632374 (-) | 777 | WP_000971301.1 | isoprenyl transferase | - |
| KM388_RS18830 (KM388_18820) | frr | 3632460..3633017 (-) | 558 | WP_000531503.1 | ribosome recycling factor | - |
| KM388_RS18835 (KM388_18825) | pyrH | 3633020..3633742 (-) | 723 | WP_000042663.1 | UMP kinase | - |
| KM388_RS18840 (KM388_18830) | tsf | 3633809..3634696 (-) | 888 | WP_001018581.1 | translation elongation factor Ts | - |
| KM388_RS18845 (KM388_18835) | rpsB | 3634800..3635501 (-) | 702 | WP_000111483.1 | 30S ribosomal protein S2 | - |
| KM388_RS18850 (KM388_18840) | codY | 3635851..3636630 (-) | 780 | WP_000421288.1 | GTP-sensing pleiotropic transcriptional regulator CodY | Regulator |
| KM388_RS18855 (KM388_18845) | hslU | 3636708..3638099 (-) | 1392 | WP_000550088.1 | ATP-dependent protease ATPase subunit HslU | - |
| KM388_RS18860 (KM388_18850) | hslV | 3638122..3638664 (-) | 543 | WP_000526272.1 | ATP-dependent protease proteolytic subunit HslV | - |
| KM388_RS18865 (KM388_18855) | xerC | 3638707..3639606 (-) | 900 | WP_001101226.1 | tyrosine recombinase XerC | - |
| KM388_RS18870 (KM388_18860) | trmFO | 3639672..3640976 (-) | 1305 | WP_001991958.1 | FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO | - |
| KM388_RS18875 (KM388_18865) | topA | 3641027..3643105 (-) | 2079 | WP_001286969.1 | type I DNA topoisomerase | - |
| KM388_RS28745 | dprA | 3643250..3643540 (-) | 291 | WP_324254321.1 | DNA-processing protein DprA | Machinery gene |
| KM388_RS28750 | - | 3643453..3643653 (-) | 201 | WP_264371026.1 | DNA-protecting protein DprA | - |
| KM388_RS28755 | - | 3643643..3644119 (-) | 477 | WP_264371027.1 | DNA-protecting protein DprA | - |
| KM388_RS18885 (KM388_18875) | sucD | 3644207..3645109 (-) | 903 | WP_000115178.1 | succinate--CoA ligase subunit alpha | - |
| KM388_RS18890 (KM388_18880) | sucC | 3645130..3646290 (-) | 1161 | WP_001020786.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| KM388_RS18895 (KM388_18885) | rnhB | 3646484..3647257 (-) | 774 | WP_001174713.1 | ribonuclease HII | - |
| KM388_RS18900 (KM388_18890) | ylqF | 3647309..3648199 (-) | 891 | WP_000236707.1 | ribosome biogenesis GTPase YlqF | - |
| KM388_RS18905 (KM388_18895) | lepB | 3648220..3648771 (-) | 552 | WP_000711857.1 | signal peptidase I | - |
| KM388_RS18910 (KM388_18900) | rplS | 3648873..3649217 (-) | 345 | WP_001186516.1 | 50S ribosomal protein L19 | - |
| KM388_RS18915 (KM388_18905) | trmD | 3649364..3650098 (-) | 735 | WP_000686892.1 | tRNA (guanosine(37)-N1)-methyltransferase TrmD | - |
| KM388_RS18920 (KM388_18910) | rimM | 3650098..3650613 (-) | 516 | WP_000170269.1 | ribosome maturation factor RimM | - |
| KM388_RS18925 (KM388_18915) | - | 3650734..3650961 (-) | 228 | WP_000737398.1 | KH domain-containing protein | - |
| KM388_RS18930 (KM388_18920) | rpsP | 3650976..3651248 (-) | 273 | WP_000268750.1 | 30S ribosomal protein S16 | - |
| KM388_RS18935 (KM388_18925) | ffh | 3651349..3652698 (-) | 1350 | WP_000863456.1 | signal recognition particle protein | - |
| KM388_RS18940 (KM388_18930) | - | 3652711..3653043 (-) | 333 | WP_000891062.1 | putative DNA-binding protein | - |
| KM388_RS18945 (KM388_18935) | ftsY | 3653177..3654166 (-) | 990 | WP_000007650.1 | signal recognition particle-docking protein FtsY | - |
| KM388_RS18950 (KM388_18940) | smc | 3654182..3657751 (-) | 3570 | WP_000478986.1 | chromosome segregation protein SMC | - |
| KM388_RS18955 (KM388_18945) | rncS | 3657898..3658635 (-) | 738 | WP_001146873.1 | ribonuclease III | - |
| KM388_RS18960 (KM388_18950) | acpP | 3658694..3658927 (-) | 234 | WP_000786062.1 | acyl carrier protein | - |
| KM388_RS18965 (KM388_18955) | fabG | 3658997..3659737 (-) | 741 | WP_000911782.1 | 3-oxoacyl-[acyl-carrier-protein] reductase | - |
| KM388_RS18970 (KM388_18960) | fabD | 3659737..3660681 (-) | 945 | WP_000516948.1 | ACP S-malonyltransferase | - |
| KM388_RS18975 (KM388_18965) | plsX | 3660696..3661688 (-) | 993 | WP_000684111.1 | phosphate acyltransferase PlsX | - |
| KM388_RS18980 (KM388_18970) | fapR | 3661685..3662278 (-) | 594 | WP_000747352.1 | transcription factor FapR | - |
| KM388_RS18985 (KM388_18975) | recG | 3662367..3664415 (-) | 2049 | WP_001006884.1 | ATP-dependent DNA helicase RecG | - |
| KM388_RS18990 (KM388_18980) | - | 3664705..3666381 (-) | 1677 | WP_000027136.1 | DAK2 domain-containing protein | - |
| KM388_RS18995 (KM388_18985) | - | 3666404..3666766 (-) | 363 | WP_000021109.1 | Asp23/Gls24 family envelope stress response protein | - |
| KM388_RS19000 (KM388_18990) | rpmB | 3667145..3667333 (+) | 189 | WP_000124778.1 | 50S ribosomal protein L28 | - |
| KM388_RS19005 (KM388_18995) | spoVM | 3667407..3667487 (-) | 81 | WP_001213599.1 | stage V sporulation protein SpoVM | - |
| KM388_RS19010 (KM388_19000) | - | 3667554..3668234 (-) | 681 | WP_025388434.1 | thiamine diphosphokinase | - |
| KM388_RS19015 (KM388_19005) | rpe | 3668334..3668978 (-) | 645 | WP_000589969.1 | ribulose-phosphate 3-epimerase | - |
| KM388_RS19020 (KM388_19010) | rsgA | 3668981..3669862 (-) | 882 | WP_001113935.1 | ribosome small subunit-dependent GTPase A | - |
| KM388_RS19025 (KM388_19015) | prkC | 3670131..3672104 (-) | 1974 | WP_000904759.1 | serine/threonine protein kinase PrkC | - |
| KM388_RS19030 (KM388_19020) | - | 3672113..3672865 (-) | 753 | WP_000648699.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| KM388_RS19035 (KM388_19025) | rlmN | 3672870..3673958 (-) | 1089 | WP_000450543.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| KM388_RS19040 (KM388_19030) | rsmB | 3673963..3675297 (-) | 1335 | WP_001249680.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
Sequence
Protein
Download Length: 96 a.a. Molecular weight: 10600.29 Da Isoelectric Point: 9.7220
>NTDB_id=573688 KM388_RS28745 WP_324254321.1 3643250..3643540(-) (dprA) [Bacillus anthracis strain SA020]
MYIVINRVSSALCTKKWYFPKRNRIISGISKGVLVVEAKSRSGTLITADLALEQNREVFALPGPIFTDSASGTNHLIQQG
AKLVRNAEDILEEILN
MYIVINRVSSALCTKKWYFPKRNRIISGISKGVLVVEAKSRSGTLITADLALEQNREVFALPGPIFTDSASGTNHLIQQG
AKLVRNAEDILEEILN
Nucleotide
Download Length: 291 bp
>NTDB_id=573688 KM388_RS28745 WP_324254321.1 3643250..3643540(-) (dprA) [Bacillus anthracis strain SA020]
ATATATATTGTTATTAACAGAGTATCCTCCGCACTATGCACCAAAAAATGGTATTTTCCAAAAAGGAATCGAATTATTAG
TGGTATAAGTAAAGGTGTTTTAGTTGTAGAAGCGAAATCGAGAAGCGGAACACTTATTACTGCAGACCTTGCTCTAGAGC
AAAATAGAGAGGTATTTGCACTTCCTGGACCTATATTTACAGATAGTGCATCAGGAACAAATCATCTTATTCAACAAGGA
GCGAAACTAGTAAGAAATGCAGAAGATATACTAGAAGAGATTTTAAATTAA
ATATATATTGTTATTAACAGAGTATCCTCCGCACTATGCACCAAAAAATGGTATTTTCCAAAAAGGAATCGAATTATTAG
TGGTATAAGTAAAGGTGTTTTAGTTGTAGAAGCGAAATCGAGAAGCGGAACACTTATTACTGCAGACCTTGCTCTAGAGC
AAAATAGAGAGGTATTTGCACTTCCTGGACCTATATTTACAGATAGTGCATCAGGAACAAATCATCTTATTCAACAAGGA
GCGAAACTAGTAAGAAATGCAGAAGATATACTAGAAGAGATTTTAAATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.