NTDB

Overview

Name	pilA	Type	Machinery gene
Locus tag	HW090_RS06950	Genome accession	NZ_CP058349
Coordinates	1582664..1582834 (+)	Length	56 a.a.
NCBI ID	WP_179112828.1	Uniprot ID	A0A7L5RSC6
Organism	Pseudomonas sp. ABC1
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1577664..1587834

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HW090_RS06925 (HW090_06925)	yacG	1577697..1577888 (-)	192	WP_179112825.1	DNA gyrase inhibitor YacG	-
HW090_RS06930 (HW090_06930)	coaE	1577885..1578493 (-)	609	WP_373416369.1	dephospho-CoA kinase	-
HW090_RS06935 (HW090_06935)	pilD	1578569..1579438 (-)	870	WP_179112827.1	A24 family peptidase	Machinery gene
HW090_RS06940 (HW090_06940)	pilC	1579442..1580647 (-)	1206	WP_256930759.1	type II secretion system F family protein	Machinery gene
HW090_RS06945 (HW090_06945)	pilB	1580660..1582363 (-)	1704	WP_256930760.1	type IV-A pilus assembly ATPase PilB	Machinery gene
HW090_RS06950 (HW090_06950)	pilA	1582664..1582834 (+)	171	WP_179112828.1	type IV pilin protein	Machinery gene
HW090_RS06955 (HW090_06955)	-	1582847..1583317 (+)	471	WP_179112829.1	hypothetical protein	-
HW090_RS06960 (HW090_06960)	-	1583671..1584240 (-)	570	WP_179112830.1	YiiX/YebB-like N1pC/P60 family cysteine hydrolase	-
HW090_RS06965 (HW090_06965)	-	1584240..1584644 (-)	405	WP_179112831.1	DUF4878 domain-containing protein	-
HW090_RS06970 (HW090_06970)	-	1584731..1585072 (+)	342	WP_179112832.1	FKBP-type peptidyl-prolyl cis-trans isomerase	-
HW090_RS06975 (HW090_06975)	-	1585133..1585768 (-)	636	WP_179112833.1	pseudouridine synthase	-
HW090_RS06980 (HW090_06980)	atzF	1585990..1587780 (+)	1791	WP_179112834.1	allophanate hydrolase	-

Sequence

Protein

Download Length: 56 a.a. Molecular weight: 6012.95 Da Isoelectric Point: 4.6356

                                >NTDB_id=463994 HW090_RS06950 WP_179112828.1 1582664..1582834(+) (pilA) [Pseudomonas sp. ABC1]

MDKGFTLTELMIVVSIIGVLSAIAIPQFNEYRSRSNDTVATVDARNAINAMAAAQL

Nucleotide

Download Length: 171 bp

                                >NTDB_id=463994 HW090_RS06950 WP_179112828.1 1582664..1582834(+) (pilA) [Pseudomonas sp. ABC1]

ATGGACAAAGGTTTCACCCTGACAGAACTCATGATCGTGGTATCCATCATTGGCGTTCTCTCTGCCATCGCCATTCCGCA

GTTCAATGAATACCGATCCAGATCCAACGATACCGTCGCAACGGTCGATGCGCGGAACGCCATTAATGCAATGGCCGCCG

CCCAGCTCTGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(2-25)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A7L5RSC6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA	Vibrio parahaemolyticus RIMD 2210633	61.364	78.571	0.482
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	48.148	96.429	0.464
pilA/pilAI	Pseudomonas stutzeri DSM 10701	66.667	64.286	0.429
pilA	Pseudomonas aeruginosa PAK	70.588	60.714	0.429
pilA	Acinetobacter baumannii strain A118	69.697	58.929	0.411
pilA/pilA4	Thermus thermophilus HB27	50	82.143	0.411
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	67.647	60.714	0.411
pilA	Vibrio cholerae strain A1552	67.647	60.714	0.411
pilA	Vibrio cholerae C6706	67.647	60.714	0.411
pilA2	Legionella pneumophila str. Paris	62.162	66.071	0.411
pilA2	Legionella pneumophila strain ERS1305867	62.162	66.071	0.411
pilA	Acinetobacter nosocomialis M2	66.667	58.929	0.393
comE	Acinetobacter baylyi ADP1	57.895	67.857	0.393
pilA	Ralstonia pseudosolanacearum GMI1000	57.895	67.857	0.393
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	41.509	94.643	0.393
comF	Acinetobacter baylyi ADP1	61.765	60.714	0.375
pilA/pilA1	Synechocystis sp. PCC 6803	44.681	83.929	0.375
pilA/pilA1	Eikenella corrodens VA1	55.263	67.857	0.375

Detailed information NTG0463994