Detailed information NTG0037145

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: LPA_RS09950
• Genome accession: NC_014125
• Coordinates: 2223839..2224249 (-)
• Length: 136 a.a.
• NCBI ID: WP_014844212.1
• Uniprot ID: A0A378K550
• Organism: Legionella pneumophila 2300/99 Alcoy
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2218839..2229249

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LPA_RS09935 (lpa_02767)	letS	2219157..2221889 (+)	2733	WP_014844211.1	two-component system sensor histidine kinase LetS	Regulator
LPA_RS09940 (lpa_02768)	-	2221987..2223231 (+)	1245	WP_011214166.1	6-phosphofructokinase	-
LPA_RS09945 (lpa_02769)	pilA2	2223228..2223641 (-)	414	WP_013101573.1	pilin	Machinery gene
LPA_RS09950 (lpa_02770)	pilA2	2223839..2224249 (-)	411	WP_014844212.1	pilin	Machinery gene
LPA_RS09955 (lpa_02771)	-	2224552..2224869 (+)	318	WP_010947633.1	BolA family transcriptional regulator	-
LPA_RS09960 (lpa_02773)	-	2224944..2226365 (+)	1422	WP_013101576.1	APC family permease	-
LPA_RS09965 (lpa_02774)	-	2226495..2227925 (-)	1431	WP_013101577.1	cellulase family glycosylhydrolase	-
LPA_RS09970 (lpa_02776)	kdsB	2228171..2228923 (-)	753	WP_013101578.1	3-deoxy-manno-octulosonate cytidylyltransferase	-
LPA_RS09975 (lpa_02777)	-	2228920..2229099 (-)	180	WP_010947637.1	Trm112 family protein	-

Sequence

Protein

• Length: 136 a.a.
• Molecular weight: 13925.15 Da
• Isoelectric Point: 8.4715

>NTDB_id=37145 LPA_RS09950 WP_014844212.1 2223839..2224249(-) (pilA2) [Legionella pneumophila 2300/99 Alcoy]
MRQKGFTLIELMIVVAIIGILAAIAIPAYQDYTIRARVTEGLTLADSAKLAVSETAITNNALPATQAATGYVSPAATPNV
QSIAIGANGVITITYTAAAGGGTIIMTPTLQANGDVTWTCTGGTLLAKYRPASCRP

Nucleotide

• Length: 411 bp

>NTDB_id=37145 LPA_RS09950 WP_014844212.1 2223839..2224249(-) (pilA2) [Legionella pneumophila 2300/99 Alcoy]
ATGAGACAAAAGGGTTTTACTTTAATTGAGTTGATGATAGTCGTAGCGATTATCGGTATTTTGGCAGCAATCGCTATACC
AGCTTATCAAGATTACACAATACGGGCTCGTGTTACGGAAGGTCTGACCTTGGCAGATTCTGCAAAACTTGCCGTATCTG
AAACGGCTATTACCAACAACGCGTTACCAGCTACTCAGGCTGCAACGGGCTATGTGTCTCCCGCTGCTACGCCCAATGTA
CAATCAATTGCTATTGGTGCCAACGGTGTGATTACCATAACGTATACCGCTGCAGCAGGTGGTGGTACCATTATTATGAC
CCCAACTTTACAAGCAAACGGTGACGTAACCTGGACTTGTACGGGCGGTACATTATTGGCCAAATACCGACCTGCCAGTT
GCAGACCATAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (35-135)

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: A0A378K550

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila strain ERS1305867	100	100	1
pilA2	Legionella pneumophila str. Paris	98.529	100	0.985
pilA	Ralstonia pseudosolanacearum GMI1000	49.068	100	0.581
comP	Acinetobacter baylyi ADP1	53.103	100	0.566
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	37.566	100	0.522
pilA/pilA1	Eikenella corrodens VA1	39.873	100	0.463
pilE	Neisseria gonorrhoeae strain FA1090	38.462	100	0.441
pilE	Neisseria gonorrhoeae MS11	38.217	100	0.441
pilA	Haemophilus influenzae 86-028NP	40.816	100	0.441
pilA	Pseudomonas aeruginosa PAK	39.865	100	0.434
pilA/pilAI	Pseudomonas stutzeri DSM 10701	42.963	99.265	0.426
pilA	Acinetobacter baumannii strain A118	39.041	100	0.419
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.855	100	0.404
pilA	Haemophilus influenzae Rd KW20	43.307	93.382	0.404
pilA	Vibrio cholerae C6706	37.762	100	0.397
pilA	Vibrio cholerae strain A1552	37.762	100	0.397
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.762	100	0.397
pilA	Glaesserella parasuis strain SC1401	38.235	100	0.382
pilA	Vibrio parahaemolyticus RIMD 2210633	38.462	95.588	0.368