NTDB

Detailed information

Bioinformatically predicted

Overview
Genomic Context
Sequence
Domains
Secondary structure
3D structure
Transmembrane helices
Similar proteins

Overview

Name	comE	Type	Machinery gene
Locus tag	ET495_RS18545	Genome accession	NZ_CP035495
Coordinates	1574839..1574976 (-)	Length	45 a.a.
NCBI ID	WP_245993416.1	Uniprot ID	-
Organism	Xylanimonas allomyrinae strain 2JSPR-7
Function	DNA binding (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1569839..1579976

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ET495_RS07235 (ET495_07235)	rpsT	1570491..1570751 (+)	261	WP_129203827.1	30S ribosomal protein S20	-
ET495_RS07240 (ET495_07240)	holA	1571085..1572113 (-)	1029	WP_245993360.1	DNA polymerase III subunit delta	-
ET495_RS07245 (ET495_07245)	-	1572170..1574842 (-)	2673	WP_245993361.1	ComEC/Rec2 family competence protein	-
ET495_RS18545	comE	1574839..1574976 (-)	138	WP_245993416.1	helix-hairpin-helix domain-containing protein	Machinery gene
ET495_RS18555	-	1575174..1575374 (-)	201	Protein_1464	SLBB domain-containing protein	-
ET495_RS07255 (ET495_07255)	-	1576359..1577300 (-)	942	WP_129203829.1	DegV family protein	-
ET495_RS07260 (ET495_07260)	-	1577365..1579284 (+)	1920	WP_129203831.1	helicase HerA-like domain-containing protein	-

Sequence

Protein

Download Length: 45 a.a. Molecular weight: 4742.51 Da Isoelectric Point: 4.6356

                                >NTDB_id=342845 ET495_RS18545 WP_245993416.1 1574839..1574976(-) (comE) [Xylanimonas allomyrinae strain 2JSPR-7]

MGPALAARIVAWREQNGAFASVDELDQVSGIGPAMMAKVRDLVTV

Nucleotide

Download Length: 138 bp

                                >NTDB_id=342845 ET495_RS18545 WP_245993416.1 1574839..1574976(-) (comE) [Xylanimonas allomyrinae strain 2JSPR-7]

ATCGGCCCGGCGCTCGCCGCCAGGATCGTCGCCTGGCGTGAGCAGAACGGGGCGTTCGCGTCGGTCGACGAGCTCGACCA

GGTGTCCGGTATCGGGCCCGCGATGATGGCCAAGGTCCGCGACCTGGTGACGGTGTGA

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(2-44)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comE	Neisseria gonorrhoeae MS11	55.556	100	0.556
comE	Neisseria gonorrhoeae MS11	55.556	100	0.556
comE	Neisseria gonorrhoeae MS11	55.556	100	0.556
comE	Neisseria gonorrhoeae MS11	55.556	100	0.556
comEA/celA/cilE	Streptococcus pneumoniae D39	51.111	100	0.511
comEA/celA/cilE	Streptococcus mitis SK321	51.111	100	0.511
comEA/celA/cilE	Streptococcus mitis NCTC 12261	51.111	100	0.511
comEA/celA/cilE	Streptococcus pneumoniae TIGR4	51.111	100	0.511
comEA/celA/cilE	Streptococcus pneumoniae Rx1	51.111	100	0.511
comEA/celA/cilE	Streptococcus pneumoniae R6	51.111	100	0.511
comEA	Acinetobacter baylyi ADP1	46.667	100	0.467
comEA/comE1	Glaesserella parasuis strain SC1401	44.444	100	0.444
comA	Synechocystis sp. PCC 6803	43.182	97.778	0.422
comEA	Streptococcus thermophilus LMD-9	42.222	100	0.422
comEA	Bacillus subtilis subsp. subtilis str. 168	40	100	0.4
comEA	Thermus thermophilus HB27	41.86	95.556	0.4
comEA	Staphylococcus aureus N315	37.778	100	0.378
comEA	Staphylococcus aureus MW2	37.778	100	0.378
comEA	Acinetobacter baumannii strain A118	44.737	84.444	0.378
comEA	Acinetobacter baumannii D1279779	44.737	84.444	0.378
comE1/comEA	Haemophilus influenzae Rd KW20	39.535	95.556	0.378

Detailed information NTG0342845