Detailed information NTG0229597

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: CA927_RS09315
• Genome accession: NZ_CP021279
• Coordinates: 2074929..2075339 (-)
• Length: 136 a.a.
• NCBI ID: WP_027227778.1
• Uniprot ID: -
• Organism: Legionella pneumophila subsp. fraseri strain F-4198
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2069929..2080339

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CA927_RS09300	letS	2070249..2072981 (+)	2733	WP_027227781.1	two-component system sensor histidine kinase LetS	Regulator
CA927_RS09305	-	2073078..2074322 (+)	1245	WP_027227780.1	6-phosphofructokinase	-
CA927_RS09310	pilA2	2074319..2074732 (-)	414	WP_027227779.1	pilin	Machinery gene
CA927_RS09315	pilA2	2074929..2075339 (-)	411	WP_027227778.1	pilin	Machinery gene
CA927_RS09320	-	2075643..2075960 (+)	318	WP_010947633.1	BolA/IbaG family iron-sulfur metabolism protein	-
CA927_RS09325	-	2076035..2077456 (+)	1422	WP_027227777.1	APC family permease	-
CA927_RS09330	-	2077586..2079016 (-)	1431	WP_027227776.1	cellulase family glycosylhydrolase	-
CA927_RS09335	kdsB	2079264..2080016 (-)	753	WP_027227775.1	3-deoxy-manno-octulosonate cytidylyltransferase	-
CA927_RS09340	-	2080013..2080192 (-)	180	WP_011215882.1	Trm112 family protein	-

Sequence

Protein

• Length: 136 a.a.
• Molecular weight: 13939.18 Da
• Isoelectric Point: 8.4715

>NTDB_id=229597 CA927_RS09315 WP_027227778.1 2074929..2075339(-) (pilA2) [Legionella pneumophila subsp. fraseri strain F-4198]
MRQKGFTLIELMIVVAIIGILAAIAIPAYQDYTIRARVTEGLTLADSAKLAVSETAITNNALPATQAATGYVSPAATPNV
QSIAIGANGVITITYTAAAGGGTIIMTPTLQANGDVTWTCTAGTLLAKYRPASCRP

Nucleotide

• Length: 411 bp

>NTDB_id=229597 CA927_RS09315 WP_027227778.1 2074929..2075339(-) (pilA2) [Legionella pneumophila subsp. fraseri strain F-4198]
ATGAGACAAAAGGGTTTTACTTTAATTGAATTGATGATAGTCGTAGCGATTATCGGTATTTTGGCAGCAATCGCTATACC
AGCCTATCAAGATTACACAATACGAGCTCGTGTTACTGAAGGTCTGACCTTGGCAGATTCTGCAAAACTTGCCGTATCTG
AAACGGCTATTACCAACAACGCGTTACCTGCTACTCAGGCTGCAACAGGCTACGTGTCTCCCGCTGCTACGCCCAATGTA
CAATCAATTGCTATTGGTGCGAACGGTGTGATTACCATAACGTATACTGCTGCAGCAGGTGGCGGCACCATTATTATGAC
CCCAACTTTGCAAGCCAACGGTGACGTAACCTGGACTTGTACGGCCGGTACATTATTGGCCAAATACCGACCTGCCAGTT
GCAGACCATAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (35-135)

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila strain ERS1305867	99.265	100	0.993
pilA2	Legionella pneumophila str. Paris	97.794	100	0.978
pilA	Ralstonia pseudosolanacearum GMI1000	49.689	100	0.588
comP	Acinetobacter baylyi ADP1	53.103	100	0.566
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	36.508	100	0.507
pilA/pilA1	Eikenella corrodens VA1	39.873	100	0.463
pilA	Haemophilus influenzae 86-028NP	40.816	100	0.441
pilE	Neisseria gonorrhoeae MS11	37.58	100	0.434
pilA/pilAI	Pseudomonas stutzeri DSM 10701	43.704	99.265	0.434
pilA	Pseudomonas aeruginosa PAK	39.865	100	0.434
pilA	Haemophilus influenzae Rd KW20	41.727	100	0.426
pilA	Acinetobacter baumannii strain A118	39.041	100	0.419
pilA	Vibrio cholerae C6706	38.621	100	0.412
pilA	Vibrio cholerae strain A1552	38.621	100	0.412
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	38.621	100	0.412
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.855	100	0.404
pilE	Neisseria gonorrhoeae strain FA1090	43.2	91.912	0.397
pilA	Vibrio parahaemolyticus RIMD 2210633	38.462	95.588	0.368
pilA	Glaesserella parasuis strain SC1401	39.37	93.382	0.368