Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SMU_RS08520 | Genome accession | NC_004350 |
| Coordinates | 1755859..1756353 (-) | Length | 164 a.a. |
| NCBI ID | WP_002261867.1 | Uniprot ID | A0AAX1K2T1 |
| Organism | Streptococcus mutans UA159 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1741267..1820659 | 1755859..1756353 | within | 0 |
Gene organization within MGE regions
Location: 1741267..1820659
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMU_RS08440 (SMU.1843) | - | 1741398..1742837 (+) | 1440 | WP_002262658.1 | sucrose-6-phosphate hydrolase | - |
| SMU_RS08445 (SMU.1844) | - | 1742840..1743802 (+) | 963 | WP_002262659.1 | LacI family DNA-binding transcriptional regulator | - |
| SMU_RS08450 (SMU.1845) | nusB | 1743996..1744424 (-) | 429 | WP_002262660.1 | transcription antitermination factor NusB | - |
| SMU_RS08455 (SMU.1846c) | - | 1744417..1744806 (-) | 390 | WP_002262661.1 | Asp23/Gls24 family envelope stress response protein | - |
| SMU_RS08460 (SMU.1847) | efp | 1744849..1745409 (-) | 561 | WP_002262662.1 | elongation factor P | - |
| SMU_RS08465 (SMU.1848) | - | 1745549..1746253 (+) | 705 | WP_002262663.1 | ion transporter | - |
| SMU_RS08470 (SMU.1849) | - | 1746301..1746753 (-) | 453 | WP_002262664.1 | deoxycytidylate deaminase | - |
| SMU_RS08475 (SMU.1850) | - | 1746923..1747987 (-) | 1065 | WP_002262665.1 | M24 family metallopeptidase | - |
| SMU_RS08480 (SMU.1851) | uvrA | 1747977..1750808 (-) | 2832 | WP_002262666.1 | excinuclease ABC subunit UvrA | - |
| SMU_RS08485 | - | 1750858..1751079 (+) | 222 | WP_019313410.1 | hypothetical protein | - |
| SMU_RS08490 (SMU.1852) | - | 1751479..1752423 (+) | 945 | WP_002262667.1 | magnesium transporter CorA family protein | - |
| SMU_RS08495 (SMU.1853) | - | 1752705..1753367 (+) | 663 | WP_002262668.1 | DUF1129 domain-containing protein | - |
| SMU_RS08500 (SMU.1854) | hdrR | 1753506..1753862 (+) | 357 | WP_002262669.1 | LytTR family transcriptional regulator HdrR | Regulator |
| SMU_RS08505 (SMU.1855) | hdrM | 1753859..1754545 (+) | 687 | WP_002262670.1 | hdrR negative regulator HdrM | Regulator |
| SMU_RS08510 (SMU.1856c) | - | 1754553..1755272 (-) | 720 | WP_002262671.1 | TraX family protein | - |
| SMU_RS08515 (SMU.1858) | rpsR | 1755591..1755830 (-) | 240 | WP_000068664.1 | 30S ribosomal protein S18 | - |
| SMU_RS08520 (SMU.1859) | ssbA | 1755859..1756353 (-) | 495 | WP_002261867.1 | single-stranded DNA-binding protein | Machinery gene |
| SMU_RS08525 (SMU.1860) | rpsF | 1756371..1756661 (-) | 291 | WP_002261866.1 | 30S ribosomal protein S6 | - |
| SMU_RS08530 (SMU.1861c) | - | 1756817..1757062 (-) | 246 | WP_002263367.1 | hypothetical protein | - |
| SMU_RS08535 (SMU.1862) | - | 1757367..1757570 (+) | 204 | WP_002263366.1 | hypothetical protein | - |
| SMU_RS08540 (SMU.1865) | mutY | 1758607..1759752 (+) | 1146 | WP_002263365.1 | A/G-specific adenine glycosylase | - |
| SMU_RS08545 (SMU.1867c) | - | 1759940..1760989 (-) | 1050 | WP_002263364.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| SMU_RS08550 (SMU.1869) | trxA | 1761087..1761401 (-) | 315 | WP_002263363.1 | thioredoxin | - |
| SMU_RS08555 (SMU.1870) | - | 1761476..1763806 (-) | 2331 | WP_002263362.1 | endonuclease MutS2 | - |
| SMU_RS08560 (SMU.1871c) | - | 1763875..1764420 (-) | 546 | WP_002263361.1 | CvpA family protein | - |
| SMU_RS08565 (SMU.1872c) | - | 1764417..1764722 (-) | 306 | WP_002263360.1 | hypothetical protein | - |
| SMU_RS08570 (SMU.1873) | rnhC | 1764918..1765829 (+) | 912 | WP_002271343.1 | ribonuclease HIII | - |
| SMU_RS08575 (SMU.1874) | lepB | 1765849..1766436 (+) | 588 | WP_002263358.1 | signal peptidase I | - |
| SMU_RS08580 (SMU.1875) | - | 1766522..1768885 (+) | 2364 | WP_002263357.1 | SF1B family DNA helicase RecD2 | - |
| SMU_RS08585 (SMU.1876) | - | 1768984..1769454 (+) | 471 | WP_002263356.1 | hypothetical protein | - |
| SMU_RS08590 (SMU.1877) | - | 1770331..1771323 (+) | 993 | WP_002263355.1 | PTS sugar transporter subunit IIB | - |
| SMU_RS08595 (SMU.1878) | - | 1771358..1772176 (+) | 819 | WP_002263354.1 | PTS mannose/fructose/sorbose transporter subunit IIC | - |
| SMU_RS08600 (SMU.1879) | - | 1772191..1773117 (+) | 927 | WP_002263353.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| SMU_RS08605 (SMU.1881c) | comA/nlmT | 1773449..1775740 (-) | 2292 | WP_002263352.1 | peptide cleavage/export ABC transporter | Regulator |
| SMU_RS08610 (SMU.1882c) | - | 1776290..1776643 (-) | 354 | WP_002263351.1 | hypothetical protein | - |
| SMU_RS08615 (SMU.1883) | - | 1776962..1777330 (+) | 369 | WP_002263350.1 | DUF956 family protein | - |
| SMU_RS08620 (SMU.1884c) | - | 1777567..1778640 (-) | 1074 | WP_002263349.1 | acyltransferase | - |
| SMU_RS08625 (SMU.1886) | serS | 1779164..1780444 (+) | 1281 | WP_002263348.1 | serine--tRNA ligase | - |
| SMU_RS08630 (SMU.1889c) | - | 1781127..1781390 (-) | 264 | WP_002352361.1 | Blp family class II bacteriocin | - |
| SMU_RS08635 (SMU.1892c) | - | 1781694..1781879 (-) | 186 | WP_002263346.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | - |
| SMU_RS08645 (SMU.1895c) | - | 1783456..1783617 (-) | 162 | WP_002263734.1 | Blp family class II bacteriocin | - |
| SMU_RS08650 (SMU.1896c) | - | 1783662..1783916 (-) | 255 | WP_002263733.1 | Blp family class II bacteriocin | - |
| SMU_RS08655 (SMU.1898) | comA | 1784304..1786489 (+) | 2186 | Protein_1681 | peptide cleavage/export ABC transporter | Regulator |
| SMU_RS08660 (SMU.1900) | comB | 1786502..1787515 (+) | 1014 | WP_002263739.1 | HlyD family efflux transporter periplasmic adaptor subunit | Regulator |
| SMU_RS09965 (SMU.1902c) | - | 1787777..1787920 (-) | 144 | WP_002263740.1 | hypothetical protein | - |
| SMU_RS08665 (SMU.1904c) | - | 1788212..1789234 (-) | 1023 | WP_002263742.1 | thioredoxin family protein | - |
| SMU_RS08670 (SMU.1905c) | - | 1789720..1789908 (-) | 189 | WP_002263743.1 | Blp family class II bacteriocin | - |
| SMU_RS08675 (SMU.1906c) | - | 1790072..1790284 (-) | 213 | WP_002263744.1 | Blp family class II bacteriocin | - |
| SMU_RS09970 (SMU.1908c) | - | 1790689..1790853 (-) | 165 | WP_002265308.1 | hypothetical protein | - |
| SMU_RS10085 | - | 1791293..1791505 (+) | 213 | Protein_1688 | IS3 family transposase | - |
| SMU_RS08680 (SMU.1909c) | - | 1791628..1792032 (-) | 405 | WP_002263912.1 | hypothetical protein | - |
| SMU_RS08685 (SMU.1910c) | - | 1792179..1792598 (-) | 420 | WP_002263913.1 | hypothetical protein | - |
| SMU_RS08690 (SMU.1913c) | - | 1793979..1794380 (-) | 402 | WP_002310604.1 | hypothetical protein | - |
| SMU_RS08695 (SMU.1914c) | cipB | 1794511..1794741 (-) | 231 | WP_002265368.1 | Blp family class II bacteriocin | Regulator |
| SMU_RS08700 (SMU.1915) | comC/blpC | 1795008..1795148 (+) | 141 | WP_002267610.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | Regulator |
| SMU_RS08705 (SMU.1916) | comD/blpH | 1795290..1796615 (-) | 1326 | WP_002262113.1 | sensor histidine kinase | Regulator |
| SMU_RS08710 (SMU.1917) | comE/blpR | 1796612..1797364 (-) | 753 | WP_002262114.1 | response regulator transcription factor | Regulator |
| SMU_RS08715 (SMU.1918) | - | 1797836..1798474 (-) | 639 | WP_002262115.1 | VTT domain-containing protein | - |
| SMU_RS08720 (SMU.1919) | - | 1798521..1799147 (-) | 627 | WP_002262116.1 | hypothetical protein | - |
| SMU_RS08725 (SMU.1920) | der | 1799222..1800532 (-) | 1311 | WP_002262117.1 | ribosome biogenesis GTPase Der | - |
| SMU_RS08730 (SMU.1921) | dnaI | 1800545..1801444 (-) | 900 | WP_002262118.1 | primosomal protein DnaI | - |
| SMU_RS08735 (SMU.1922) | - | 1801445..1802614 (-) | 1170 | WP_002262119.1 | DnaD domain protein | - |
| SMU_RS08740 (SMU.1923c) | nrdR | 1802601..1803092 (-) | 492 | WP_002262120.1 | transcriptional regulator NrdR | - |
| SMU_RS08745 (SMU.1924) | covR | 1803462..1804154 (-) | 693 | WP_002262121.1 | response regulator GcrR | Regulator |
| SMU_RS08750 (SMU.1925c) | - | 1804511..1805047 (-) | 537 | WP_002262122.1 | DUF177 domain-containing protein | - |
| SMU_RS08755 (SMU.1926) | - | 1805040..1805615 (-) | 576 | WP_002262123.1 | TetR/AcrR family transcriptional regulator | - |
| SMU_RS08760 (SMU.1927) | - | 1805723..1806430 (+) | 708 | WP_002262124.1 | ABC transporter ATP-binding protein | - |
| SMU_RS08765 (SMU.1928) | - | 1806432..1809044 (+) | 2613 | WP_002263841.1 | ABC transporter permease | - |
| SMU_RS08770 (SMU.1929) | htpX | 1809181..1810080 (-) | 900 | WP_002262126.1 | zinc metalloprotease HtpX | - |
| SMU_RS08775 (SMU.1930) | - | 1810090..1810650 (-) | 561 | WP_002262127.1 | LemA family protein | - |
| SMU_RS08780 (SMU.1931) | rsmG | 1810738..1811451 (+) | 714 | WP_002262128.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| SMU_RS08785 (SMU.1933c) | - | 1811675..1812508 (-) | 834 | WP_002262129.1 | energy-coupling factor transporter transmembrane component T family protein | - |
| SMU_RS08790 (SMU.1934c) | - | 1812501..1814177 (-) | 1677 | WP_002262130.1 | ABC transporter ATP-binding protein | - |
| SMU_RS08795 (SMU.1935c) | - | 1814206..1814751 (-) | 546 | WP_002262131.1 | ECF-type riboflavin transporter substrate-binding protein | - |
| SMU_RS08800 (SMU.1936c) | - | 1814761..1815606 (-) | 846 | WP_002262132.1 | SAM hydrolase/SAM-dependent halogenase family protein | - |
| SMU_RS08805 (SMU.1937) | - | 1815730..1816506 (-) | 777 | WP_002262133.1 | carbon-nitrogen family hydrolase | - |
| SMU_RS08810 (SMU.1938c) | - | 1816574..1817263 (-) | 690 | WP_002262134.1 | methionine ABC transporter permease | - |
| SMU_RS08815 (SMU.1939c) | - | 1817265..1818329 (-) | 1065 | WP_002262135.1 | methionine ABC transporter ATP-binding protein | - |
| SMU_RS08820 (SMU.1940c) | - | 1818322..1819695 (-) | 1374 | WP_002262136.1 | M20/M25/M40 family metallo-hydrolase | - |
Sequence
Protein
Download Length: 164 a.a. Molecular weight: 18331.97 Da Isoelectric Point: 4.7187
>NTDB_id=22430 SMU_RS08520 WP_002261867.1 1755859..1756353(-) (ssbA) [Streptococcus mutans UA159]
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQNGEREADFINIVIWRQQAENLANWAKKGTLLGITGRIQTR
NYENQQGQRVYVTEVVADNFQILESRATREGQSNSYNAGGNNNFGGNNFSSQGSSQSQTPNFARDESPFGDSNPMDISDD
DLPF
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQNGEREADFINIVIWRQQAENLANWAKKGTLLGITGRIQTR
NYENQQGQRVYVTEVVADNFQILESRATREGQSNSYNAGGNNNFGGNNFSSQGSSQSQTPNFARDESPFGDSNPMDISDD
DLPF
Nucleotide
Download Length: 495 bp
>NTDB_id=22430 SMU_RS08520 WP_002261867.1 1755859..1756353(-) (ssbA) [Streptococcus mutans UA159]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACTCGTGATGCTGAGCTCCGTTACACCCCAAGTAATCAAGCTGTGGC
AACTTTTACGCTTGCGGTTAACCGTAATTTTAAAAATCAAAATGGTGAACGTGAAGCTGATTTCATTAATATCGTGATTT
GGCGTCAGCAAGCTGAAAATTTAGCTAACTGGGCTAAAAAAGGGACTCTTTTAGGCATTACTGGTCGAATCCAGACCCGC
AATTATGAAAACCAACAAGGTCAGCGTGTTTACGTCACAGAAGTTGTTGCGGATAATTTCCAAATTTTGGAAAGTCGTGC
TACACGTGAAGGTCAATCAAACAGTTATAATGCTGGTGGTAACAATAACTTTGGCGGAAATAATTTTTCTTCCCAAGGTT
CTTCACAATCTCAAACGCCAAACTTTGCTAGAGATGAAAGTCCATTTGGTGATTCAAATCCTATGGATATTTCAGACGAT
GATCTTCCGTTTTAA
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACTCGTGATGCTGAGCTCCGTTACACCCCAAGTAATCAAGCTGTGGC
AACTTTTACGCTTGCGGTTAACCGTAATTTTAAAAATCAAAATGGTGAACGTGAAGCTGATTTCATTAATATCGTGATTT
GGCGTCAGCAAGCTGAAAATTTAGCTAACTGGGCTAAAAAAGGGACTCTTTTAGGCATTACTGGTCGAATCCAGACCCGC
AATTATGAAAACCAACAAGGTCAGCGTGTTTACGTCACAGAAGTTGTTGCGGATAATTTCCAAATTTTGGAAAGTCGTGC
TACACGTGAAGGTCAATCAAACAGTTATAATGCTGGTGGTAACAATAACTTTGGCGGAAATAATTTTTCTTCCCAAGGTT
CTTCACAATCTCAAACGCCAAACTTTGCTAGAGATGAAAGTCCATTTGGTGATTCAAATCCTATGGATATTTCAGACGAT
GATCTTCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.062 |
100 |
0.616 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.059 |
100 |
0.591 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
51.261 |
72.561 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.62 |
100 |
0.372 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
52.632 |
69.512 |
0.366 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50.42 |
72.561 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
50.42 |
72.561 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
50.42 |
72.561 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
50.42 |
72.561 |
0.366 |
| ssbB/cilA | Streptococcus mitis SK321 |
50.42 |
72.561 |
0.366 |