Detailed information
Overview
| Name | ssbB/cilA | Type | Machinery gene |
| Locus tag | SPR_RS08685 | Genome accession | NC_003098 |
| Coordinates | 1704481..1704876 (-) | Length | 131 a.a. |
| NCBI ID | WP_000282467.1 | Uniprot ID | A0A098Z0L0 |
| Organism | Streptococcus pneumoniae R6 | ||
| Function | ssDNA binding DNA processing |
||
Function
SsbB is a single-stranded DNA (ssDNA)-binding protein critical for protecting internalized ssDNA and facilitating RecA-mediated homologous recombination during natural transformation. It coats ssDNA to prevent degradation, secondary structure formation, and non-specific interactions, ensuring efficient recombination and integration of exogenous DNA into the genome.
Genomic Context
Location: 1699481..1709876
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPR_RS08660 (spr1719) | - | 1699822..1700355 (+) | 534 | WP_000775321.1 | nucleoside tri-diphosphate phosphatase | - |
| SPR_RS08665 (spr1720) | - | 1700709..1700915 (-) | 207 | WP_000775827.1 | transcriptional regulator | - |
| SPR_RS08670 (spr1721) | - | 1701075..1702304 (+) | 1230 | WP_000436473.1 | ISL3 family transposase | - |
| SPR_RS08675 (spr1722) | groL | 1702403..1704025 (-) | 1623 | WP_000031573.1 | chaperonin GroEL | - |
| SPR_RS08680 (spr1723) | groES | 1704041..1704325 (-) | 285 | WP_000917304.1 | co-chaperone GroES | - |
| SPR_RS08685 (spr1724) | ssbB/cilA | 1704481..1704876 (-) | 396 | WP_000282467.1 | single-stranded DNA-binding protein | Machinery gene |
| SPR_RS08690 (spr1725) | - | 1704954..1705715 (-) | 762 | WP_001107755.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| SPR_RS08695 (spr1726) | ytpR | 1705748..1706374 (-) | 627 | WP_000578309.1 | YtpR family tRNA-binding protein | - |
| SPR_RS08700 (spr1727) | - | 1706390..1706707 (-) | 318 | WP_000615767.1 | thioredoxin family protein | - |
| SPR_RS08705 (spr1728) | - | 1706704..1707003 (-) | 300 | WP_001013974.1 | DUF4651 domain-containing protein | - |
| SPR_RS11010 | - | 1707097..1707228 (+) | 132 | WP_001811306.1 | hypothetical protein | - |
| SPR_RS10865 | - | 1707253..1707315 (-) | 63 | WP_219300018.1 | hypothetical protein | - |
| SPR_RS08710 (spr1729) | - | 1707340..1707531 (-) | 192 | WP_000291826.1 | cell wall-binding protein | - |
| SPR_RS08715 (spr1730) | - | 1707692..1708366 (-) | 675 | WP_000725742.1 | LiaF transmembrane domain-containing protein | - |
| SPR_RS08720 (spr1731) | - | 1708372..1708818 (-) | 447 | WP_000776587.1 | LytTR family DNA-binding domain-containing protein | - |
| SPR_RS08725 (spr1732) | - | 1708932..1709435 (-) | 504 | WP_000800927.1 | phosphatase PAP2 family protein | - |
| SPR_RS08730 (spr1733) | - | 1709432..1709794 (-) | 363 | WP_000078805.1 | DUF2200 domain-containing protein | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14925.89 Da Isoelectric Point: 5.9409
MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR
RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF
Nucleotide
Download Length: 396 bp
ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC
GCGAGCAACTATCGCTGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTTAATATGGTTCTAT
GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT
CGCTTTGAGAAAAATGGTCAGATGAATTATGTAACCGAAGTCCTTGTGACAGGATTCCAACTCTTGGAAAGTCGTGCCCA
ACGTGCTATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTGGTCTTGGAAGAGGAAGAATTGCCATTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB/cilA | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
99.237 |
100 |
0.992 |
| ssbB/cilA | Streptococcus mitis SK321 |
98.473 |
100 |
0.985 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
98.473 |
100 |
0.985 |
| ssbA | Streptococcus mutans UA159 |
74.809 |
100 |
0.748 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
70.229 |
100 |
0.702 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
56.923 |
100 |
0.574 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
43.519 |
95.575 |
0.416 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.903 |
86.26 |
0.405 |
Multiple sequence alignment
References
| [1] | Diane E Grove et al. (2012) Stimulation of the Streptococcus pneumoniae RecA protein-promoted three-strand exchange reaction by the competence-specific SsbB protein. Biochemical And Biophysical Research Communications 424(1):40-4. [PMID: 22713474] |
| [2] | Laetitia Attaiech et al. (2011) Role of the single-stranded DNA-binding protein SsbB in pneumococcal transformation: maintenance of a reservoir for genetic plasticity. PLoS Genetics 7(6):e1002156. [PMID: 21738490] |
| [3] | Brenda Salerno et al. (2011) DNA binding compatibility of the Streptococcus pneumoniae SsbA and SsbB proteins. PloS One 6(9):e24305. [PMID: 21915308] |
| [4] | Donald A Morrison et al. (2007) Identification of the major protein component of the pneumococcal eclipse complex. Journal of Bacteriology 189(17):6497-500. [PMID: 17601792] |
| [5] | Diane E Grove et al. (2006) Effect of Mg2+ on the DNA binding modes of the Streptococcus pneumoniae SsbA and SsbB proteins. The Journal of Biological Chemistry 281(4):2087-94. [PMID: 16298996] |
| [6] | Diane E Grove et al. (2005) Differential single-stranded DNA binding properties of the paralogous SsbA and SsbB proteins from Streptococcus pneumoniae. The Journal of Biological Chemistry 280(12):11067-73. [PMID: 15647253] |
| [7] | Mohammad A Hedayati et al. (2005) Expression and purification of the SsbB protein from Streptococcus pneumoniae. Protein Expression And Purification 43(2):133-9. [PMID: 15886018] |
| [8] | Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980] |