Detailed information
Overview
| Name | ssbB | Type | Machinery gene |
| Locus tag | BSU_36310 | Genome accession | NC_000964 |
| Coordinates | 3740206..3740547 (-) | Length | 113 a.a. |
| NCBI ID | NP_391512.2 | Uniprot ID | C0SPB6 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | ssDNA binding DNA processing |
||
Genomic Context
Location: 3735206..3745547
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_36280 (BSU36280) | hepA | 3735449..3738217 (+) | 2769 | NP_391509.1 | ATPase involved in RNA remodelling DNA recombination and repair | - |
| BSU_36290 (BSU36290) | ywpJ | 3738343..3739200 (-) | 858 | NP_391510.1 | phosphatase of unidentified specificity (possibly promiscuous) | - |
| BSU_36300 (BSU36300) | glcR | 3739206..3739982 (-) | 777 | NP_391511.1 | transcriptional regulator (glucose repression of catabolic operons) | - |
| BSU_36310 (BSU36310) | ssbB | 3740206..3740547 (-) | 342 | NP_391512.2 | single-strand DNA-binding protein | Machinery gene |
| BSU_36320 (BSU36320) | ywpG | 3740624..3741007 (-) | 384 | NP_391513.1 | interaction partner of DynA | - |
| BSU_36330 (BSU36330) | ywpF | 3741182..3741592 (+) | 411 | NP_391514.1 | hypothetical protein | - |
| BSU_36340 (BSU36340) | ywpE | 3741732..3742040 (-) | 309 | NP_391515.1 | putative sortase | - |
| BSU_36350 (BSU36350) | ywpD | 3742384..3743220 (+) | 837 | NP_391516.1 | putative two-component sensor histidine kinase | - |
| BSU_36360 (BSU36360) | mscL | 3743267..3743659 (-) | 393 | NP_391517.1 | large conductance mechanosensitive channel protein | - |
| BSU_36370 (BSU36370) | fabZ | 3743732..3744157 (-) | 426 | NP_391518.2 | beta-hydroxyacyl-[acyl carrier protein] dehydratase | - |
| BSU_36380 (BSU36380) | rapD | 3744349..3745413 (+) | 1065 | NP_391519.1 | response regulator aspartate phosphatase | - |
Sequence
Protein
Download Length: 113 a.a. Molecular weight: 12520.15 Da Isoelectric Point: 6.9498
>NTDB_id=112 BSU_36310 NP_391512.2 3740206..3740547(-) (ssbB) [Bacillus subtilis subsp. subtilis str. 168]
MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTR
SYENEEGVNVYVTEVLADTVRFMDPKPREKAAD
MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTR
SYENEEGVNVYVTEVLADTVRFMDPKPREKAAD
Nucleotide
Download Length: 342 bp
>NTDB_id=112 BSU_36310 NP_391512.2 3740206..3740547(-) (ssbB) [Bacillus subtilis subsp. subtilis str. 168]
ATGTTCAATCAGGTCATGCTTGTCGGACGTCTTACAAAAGATCCTGATCTTCGCTACACTTCCGCCGGTGCGGCAGTTGC
ACATGTTACGCTCGCGGTGAACCGCAGCTTCAAGAATGCTTCAGGTGAAATCGAAGCTGATTACGTCAATTGCACACTTT
GGAGAAAAACAGCTGAAAACACGGCGTTGTATTGCCAAAAAGGTTCTCTCGTCGGCGTAAGCGGACGGATTCAGACAAGA
AGCTATGAAAACGAGGAAGGCGTTAACGTGTATGTAACAGAAGTGTTGGCTGACACTGTTCGTTTTATGGACCCTAAACC
CCGGGAAAAAGCTGCTGATTGA
ATGTTCAATCAGGTCATGCTTGTCGGACGTCTTACAAAAGATCCTGATCTTCGCTACACTTCCGCCGGTGCGGCAGTTGC
ACATGTTACGCTCGCGGTGAACCGCAGCTTCAAGAATGCTTCAGGTGAAATCGAAGCTGATTACGTCAATTGCACACTTT
GGAGAAAAACAGCTGAAAACACGGCGTTGTATTGCCAAAAAGGTTCTCTCGTCGGCGTAAGCGGACGGATTCAGACAAGA
AGCTATGAAAACGAGGAAGGCGTTAACGTGTATGTAACAGAAGTGTTGGCTGACACTGTTCGTTTTATGGACCCTAAACC
CCGGGAAAAAGCTGCTGATTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
64.151 |
93.805 |
0.602 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
59.434 |
93.805 |
0.558 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
45.37 |
95.575 |
0.434 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.444 |
95.575 |
0.425 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.444 |
95.575 |
0.425 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.519 |
95.575 |
0.416 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.519 |
95.575 |
0.416 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.519 |
95.575 |
0.416 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.519 |
95.575 |
0.416 |
| ssbA | Streptococcus mutans UA159 |
44.34 |
93.805 |
0.416 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
41.905 |
92.92 |
0.389 |
Multiple sequence alignment
References
| [1] | Tribhuwan Yadav et al. (2014) Roles of Bacillus subtilis DprA and SsbA in RecA-mediated genetic recombination. The Journal of Biological Chemistry 289(40):27640-52. [PMID: 25138221] |
| [2] | Tribhuwan Yadav et al. (2013) Bacillus subtilis DprA recruits RecA onto single-stranded DNA and mediates annealing of complementary strands coated by SsbB and SsbA. The Journal of Biological Chemistry 288(31):22437-50. [PMID: 23779106] |
| [3] | Tribhuwan Yadav et al. (2012) Genetic recombination in Bacillus subtilis: a division of labor between two single-strand DNA-binding proteins. Nucleic Acids Research 40(12):5546-59. [PMID: 22373918] |
| [4] | Naomi Kramer et al. (2007) Multiple interactions among the competence proteins of Bacillus subtilis. Molecular Microbiology 65(2):454-64. [PMID: 17630974] |
| [5] | Ivan Mijakovic et al. (2006) Bacterial single-stranded DNA-binding proteins are phosphorylated on tyrosine. Nucleic Acids Research 34(5):1588-96. [PMID: 16549871] |
| [6] | Cordula Lindner et al. (2004) Differential expression of two paralogous genes of Bacillus subtilis encoding single-stranded DNA binding protein. Journal of Bacteriology 186(4):1097-105. [PMID: 14762004] |