Detailed information NTG0000158

Experimentally validated

Overview

• Name: ssbB/cilA
• Type: Machinery gene
• Locus tag: SP_RS09595
• Genome accession: NC_003028
• Coordinates: 1822440..1822835 (-)
• Length: 131 a.a.
• NCBI ID: WP_000282442.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae TIGR4
• Function: ssDNA binding DNA processing

Function

SsbB is a single-stranded DNA (ssDNA)-binding protein critical for protecting internalized ssDNA and facilitating RecA-mediated homologous recombination during natural transformation. It coats ssDNA to prevent degradation, secondary structure formation, and non-specific interactions, ensuring efficient recombination and integration of exogenous DNA into the genome.

Genomic Context

Location: 1817440..1827835

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SP_RS09565 (SP_1903)	ntdP	1817703..1818236 (+)	534	WP_000775321.1	nucleoside tri-diphosphate phosphatase	-
SP_RS12415 (SP_1904)	-	1818590..1818796 (-)	207	WP_000768520.1	transcriptional regulator	-
SP_RS12420 (SP_1905)	-	1818957..1820263 (+)	1307	Protein_1806	transposase	-
SP_RS09585 (SP_1906)	groL	1820362..1821984 (-)	1623	WP_000031573.1	chaperonin GroEL	-
SP_RS09590 (SP_1907)	groES	1822000..1822284 (-)	285	WP_000917330.1	co-chaperone GroES	-
SP_RS09595 (SP_1908)	ssbB/cilA	1822440..1822835 (-)	396	WP_000282442.1	single-stranded DNA-binding protein	Machinery gene
SP_RS09600 (SP_1909)	-	1822913..1823674 (-)	762	WP_001107746.1	SDR family NAD(P)-dependent oxidoreductase	-
SP_RS09605 (SP_1910)	ytpR	1823716..1824342 (-)	627	WP_000578285.1	YtpR family tRNA-binding protein	-
SP_RS09610 (SP_1911)	-	1824358..1824675 (-)	318	WP_000615765.1	thioredoxin family protein	-
SP_RS09615 (SP_1912)	-	1824672..1824971 (-)	300	WP_001013974.1	DUF4651 domain-containing protein	-
SP_RS13690	-	1825065..1825196 (+)	132	WP_001811306.1	hypothetical protein	-
SP_RS13500	-	1825221..1825301 (-)	81	WP_223200463.1	hypothetical protein	-
SP_RS09625	-	1825308..1825499 (-)	192	WP_000291826.1	cell wall-binding protein	-
SP_RS09630 (SP_1914)	-	1825660..1826334 (-)	675	WP_000725749.1	LiaF transmembrane domain-containing protein	-
SP_RS09635 (SP_1915)	-	1826340..1826786 (-)	447	WP_000776589.1	LytTR family DNA-binding domain-containing protein	-
SP_RS09640 (SP_1916)	-	1826900..1827403 (-)	504	WP_000800931.1	phosphatase PAP2 family protein	-
SP_RS09645 (SP_1917)	-	1827400..1827762 (-)	363	WP_000078805.1	DUF2200 domain-containing protein	-

Sequence

Protein

• Length: 131 a.a.
• Molecular weight: 14907.85 Da
• Isoelectric Point: 5.9409

>NTDB_id=158 SP_RS09595 WP_000282442.1 1822440..1822835(-) (ssbB/cilA) [Streptococcus pneumoniae TIGR4]
MYNKVILIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR
RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF

Nucleotide

• Length: 396 bp

>NTDB_id=158 SP_RS09595 WP_000282442.1 1822440..1822835(-) (ssbB/cilA) [Streptococcus pneumoniae TIGR4]
ATGTATAATAAAGTTATCTTGATTGGACGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC
GCGAGCAACTATCGCTGTGAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTCAATATGGTCCTAT
GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT
CGCTTTGAGAAAAATGGCCAAATGAACTACGTGACCGAAGTACTTGTCACAGGATTCCAACTCTTGGAAAGTCGTGCCCA
ACGTGCTATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTGGTCTTGGAAGAGGAAGAATTGCCATTTTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (3-101)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB/cilA	Streptococcus mitis SK321	99.237	100	0.992
ssbB/cilA	Streptococcus pneumoniae Rx1	99.237	100	0.992
ssbB/cilA	Streptococcus pneumoniae D39	99.237	100	0.992
ssbB/cilA	Streptococcus pneumoniae R6	99.237	100	0.992
ssbB/cilA	Streptococcus mitis NCTC 12261	97.71	100	0.977
ssbA	Streptococcus mutans UA159	75.573	100	0.756
ssbB	Streptococcus sobrinus strain NIDR 6715-7	70.992	100	0.71
ssbB	Lactococcus lactis subsp. cremoris KW2	57.692	100	0.581
ssbB	Bacillus subtilis subsp. subtilis str. 168	44.444	95.575	0.425
ssbA	Bacillus subtilis subsp. subtilis str. 168	51.887	80.916	0.42
ssb	Latilactobacillus sakei subsp. sakei 23K	47.788	86.26	0.412

References

• [1]: Diane E Grove et al. (2012) Stimulation of the Streptococcus pneumoniae RecA protein-promoted three-strand exchange reaction by the competence-specific SsbB protein. Biochemical And Biophysical Research Communications 424(1):40-4. [PMID: 22713474]
• [2]: Laetitia Attaiech et al. (2011) Role of the single-stranded DNA-binding protein SsbB in pneumococcal transformation: maintenance of a reservoir for genetic plasticity. PLoS Genetics 7(6):e1002156. [PMID: 21738490]
• [3]: Brenda Salerno et al. (2011) DNA binding compatibility of the Streptococcus pneumoniae SsbA and SsbB proteins. PloS One 6(9):e24305. [PMID: 21915308]
• [4]: Donald A Morrison et al. (2007) Identification of the major protein component of the pneumococcal eclipse complex. Journal of Bacteriology 189(17):6497-500. [PMID: 17601792]
• [5]: Diane E Grove et al. (2006) Effect of Mg2+ on the DNA binding modes of the Streptococcus pneumoniae SsbA and SsbB proteins. The Journal of Biological Chemistry 281(4):2087-94. [PMID: 16298996]
• [6]: Diane E Grove et al. (2005) Differential single-stranded DNA binding properties of the paralogous SsbA and SsbB proteins from Streptococcus pneumoniae. The Journal of Biological Chemistry 280(12):11067-73. [PMID: 15647253]
• [7]: Mohammad A Hedayati et al. (2005) Expression and purification of the SsbB protein from Streptococcus pneumoniae. Protein Expression And Purification 43(2):133-9. [PMID: 15886018]
• [8]: Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980]