Detailed information NTG0000268

Experimentally validated

Overview

• Name: ssbB/cilA
• Type: Machinery gene
• Locus tag: KZH43_RS08520
• Genome accession: NZ_CP079923
• Coordinates: 1695934..1696329 (-)
• Length: 131 a.a.
• NCBI ID: WP_000282467.1
• Uniprot ID: A0A098Z0L0
• Organism: Streptococcus pneumoniae Rx1
• Function: ssDNA binding DNA processing

Function

SsbB is a single-stranded DNA (ssDNA)-binding protein critical for protecting internalized ssDNA and facilitating RecA-mediated homologous recombination during natural transformation. It coats ssDNA to prevent degradation, secondary structure formation, and non-specific interactions, ensuring efficient recombination and integration of exogenous DNA into the genome.

Genomic Context

Location: 1690934..1701329

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KZH43_RS08495 (KZH43_08495)	-	1691275..1691808 (+)	534	WP_000775321.1	DUF402 domain-containing protein	-
KZH43_RS08500 (KZH43_08500)	-	1692162..1692368 (-)	207	WP_000775827.1	transcriptional regulator	-
KZH43_RS08505 (KZH43_08505)	-	1692528..1693757 (+)	1230	WP_000436473.1	ISL3 family transposase	-
KZH43_RS08510 (KZH43_08510)	groL	1693856..1695478 (-)	1623	WP_000031573.1	chaperonin GroEL	-
KZH43_RS08515 (KZH43_08515)	groES	1695494..1695778 (-)	285	WP_000917304.1	co-chaperone GroES	-
KZH43_RS08520 (KZH43_08520)	ssbB/cilA	1695934..1696329 (-)	396	WP_000282467.1	single-stranded DNA-binding protein	Machinery gene
KZH43_RS08525 (KZH43_08525)	-	1696407..1697168 (-)	762	WP_001107755.1	SDR family NAD(P)-dependent oxidoreductase	-
KZH43_RS08530 (KZH43_08530)	ytpR	1697201..1697827 (-)	627	WP_000578309.1	YtpR family tRNA-binding protein	-
KZH43_RS08535 (KZH43_08535)	-	1697843..1698160 (-)	318	WP_000615767.1	thioredoxin family protein	-
KZH43_RS08540 (KZH43_08540)	-	1698157..1698456 (-)	300	WP_001013974.1	DUF4651 domain-containing protein	-
KZH43_RS10690	-	1698550..1698681 (+)	132	WP_001811306.1	hypothetical protein	-
KZH43_RS08545	-	1698706..1698768 (-)	63	WP_219300018.1	hypothetical protein	-
KZH43_RS08550 (KZH43_08545)	-	1698793..1698984 (-)	192	WP_000291826.1	cell wall-binding protein	-
KZH43_RS08555 (KZH43_08550)	-	1699145..1699819 (-)	675	WP_000725742.1	membrane protein	-
KZH43_RS08560 (KZH43_08555)	-	1699825..1700271 (-)	447	WP_000776587.1	LytTR family DNA-binding domain-containing protein	-
KZH43_RS08565 (KZH43_08560)	-	1700385..1700888 (-)	504	WP_000800927.1	phosphatase PAP2 family protein	-
KZH43_RS08570 (KZH43_08565)	-	1700885..1701247 (-)	363	WP_000078805.1	DUF2200 domain-containing protein	-

Sequence

Protein

• Length: 131 a.a.
• Molecular weight: 14925.89 Da
• Isoelectric Point: 5.9409

>NTDB_id=268 KZH43_RS08520 WP_000282467.1 1695934..1696329(-) (ssbB/cilA) [Streptococcus pneumoniae Rx1]
MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR
RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF

Nucleotide

• Length: 396 bp

>NTDB_id=268 KZH43_RS08520 WP_000282467.1 1695934..1696329(-) (ssbB/cilA) [Streptococcus pneumoniae Rx1]
ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC
GCGAGCAACTATCGCTGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTTAATATGGTTCTAT
GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT
CGCTTTGAGAAAAATGGTCAGATGAATTATGTAACCGAAGTCCTTGTGACAGGATTCCAACTCTTGGAAAGTCGTGCCCA
ACGTGCTATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTGGTCTTGGAAGAGGAAGAATTGCCATTTTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (3-101)

3D structure

• AlphaFold DB: A0A098Z0L0

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB/cilA	Streptococcus pneumoniae D39	100	100	1
ssbB/cilA	Streptococcus pneumoniae R6	100	100	1
ssbB/cilA	Streptococcus pneumoniae TIGR4	99.237	100	0.992
ssbB/cilA	Streptococcus mitis SK321	98.473	100	0.985
ssbB/cilA	Streptococcus mitis NCTC 12261	98.473	100	0.985
ssbA	Streptococcus mutans UA159	74.809	100	0.748
ssbB	Streptococcus sobrinus strain NIDR 6715-7	70.229	100	0.702
ssbB	Lactococcus lactis subsp. cremoris KW2	56.923	100	0.574
ssbB	Bacillus subtilis subsp. subtilis str. 168	43.519	95.575	0.416
ssbA	Bacillus subtilis subsp. subtilis str. 168	50.943	80.916	0.412
ssb	Latilactobacillus sakei subsp. sakei 23K	46.903	86.26	0.405

References

• [1]: Diane E Grove et al. (2012) Stimulation of the Streptococcus pneumoniae RecA protein-promoted three-strand exchange reaction by the competence-specific SsbB protein. Biochemical And Biophysical Research Communications 424(1):40-4. [PMID: 22713474]
• [2]: Laetitia Attaiech et al. (2011) Role of the single-stranded DNA-binding protein SsbB in pneumococcal transformation: maintenance of a reservoir for genetic plasticity. PLoS Genetics 7(6):e1002156. [PMID: 21738490]
• [3]: Brenda Salerno et al. (2011) DNA binding compatibility of the Streptococcus pneumoniae SsbA and SsbB proteins. PloS One 6(9):e24305. [PMID: 21915308]
• [4]: Donald A Morrison et al. (2007) Identification of the major protein component of the pneumococcal eclipse complex. Journal of Bacteriology 189(17):6497-500. [PMID: 17601792]
• [5]: Diane E Grove et al. (2006) Effect of Mg2+ on the DNA binding modes of the Streptococcus pneumoniae SsbA and SsbB proteins. The Journal of Biological Chemistry 281(4):2087-94. [PMID: 16298996]
• [6]: Diane E Grove et al. (2005) Differential single-stranded DNA binding properties of the paralogous SsbA and SsbB proteins from Streptococcus pneumoniae. The Journal of Biological Chemistry 280(12):11067-73. [PMID: 15647253]
• [7]: Mohammad A Hedayati et al. (2005) Expression and purification of the SsbB protein from Streptococcus pneumoniae. Protein Expression And Purification 43(2):133-9. [PMID: 15886018]
• [8]: Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980]