Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | BSU_40900 | Genome accession | NC_000964 |
| Coordinates | 4198886..4199404 (-) | Length | 172 a.a. |
| NCBI ID | NP_391970.1 | Uniprot ID | P37455 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | ssDNA binding DNA processing |
||
Function
DprA-SsbA contributes to the formation of an active RecA filament and directly antagonizes the inhibitory effects of RecX during natural transformation. SsbA and RecO (or SsbA, RecO and RecR in vivo) are crucial for RecA activation for both, AddAB and RecJ-RecQ (RecS) recombinational repair pathways.
Genomic Context
Location: 4193886..4204404
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_40840 (BSU40840) | yyaJ | 4194389..4195744 (+) | 1356 | NP_391964.2 | putative transporter | - |
| BSU_40850 (BSU40850) | maa | 4195778..4196332 (-) | 555 | NP_391965.1 | maltose O-acetyltransferase | - |
| BSU_40860 (BSU40860) | yyaH | 4196350..4196730 (-) | 381 | NP_391966.1 | putative C-S lyase | - |
| BSU_40870 (BSU40870) | ccpB | 4196786..4197721 (-) | 936 | NP_391967.1 | transcriptional repressor of carbon supply (LacI family) | - |
| BSU_40880 (BSU40880) | exoA | 4197780..4198538 (-) | 759 | NP_391968.1 | apurinic/apyrimidinic endonuclease | - |
| BSU_40890 (BSU40890) | rpsR | 4198603..4198842 (-) | 240 | NP_391969.2 | ribosomal protein S18 | - |
| BSU_40900 (BSU40900) | ssbA | 4198886..4199404 (-) | 519 | NP_391970.1 | single-strand DNA-binding protein | Machinery gene |
| BSU_40910 (BSU40910) | rpsF | 4199445..4199732 (-) | 288 | NP_391971.1 | ribosomal protein S6 (BS9) | - |
| BSU_40920 (BSU40920) | engD | 4199843..4200943 (-) | 1101 | NP_391972.1 | potassium-dependent informational ATPase interacting with 70S ribosome; ROS stress regulator | - |
| BSU_40930 (BSU40930) | yyaE | 4201070..4203073 (-) | 2004 | NP_391973.1 | putative oxidoreductase (molybdoenzyme) | - |
| BSU_40939 (BSU40939) | yyzM | 4203124..4203330 (-) | 207 | YP_003097803.1 | putative nucleic acid binding protein | - |
Sequence
Protein
Download Length: 172 a.a. Molecular weight: 18742.31 Da Isoelectric Point: 4.7621
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF
Nucleotide
Download Length: 519 bp
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
64.151 |
93.805 |
0.602 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.192 |
100 |
0.599 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
51.887 |
80.916 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
50.943 |
80.916 |
0.412 |
| ssbB/cilA | Streptococcus mitis SK321 |
50.943 |
80.916 |
0.412 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
50.943 |
80.916 |
0.412 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
50.943 |
80.916 |
0.412 |
| ssbA | Streptococcus mutans UA159 |
50 |
80.916 |
0.405 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
80.916 |
0.405 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
49.057 |
80.916 |
0.397 |
| ssb | Glaesserella parasuis strain SC1401 |
35.519 |
100 |
0.378 |
Multiple sequence alignment
References
| [1] | Begoña Carrasco et al. (2022) PcrA Dissociates RecA Filaments and the SsbA and RecO Mediators Counterbalance Such Activity. Frontiers in Molecular Biosciences 9:836211. [PMID: 35223992] |
| [2] | Shimin Le et al. (2017) Bacillus subtilis RecA with DprA-SsbA antagonizes RecX function during natural transformation. Nucleic Acids Research 45(15):8873-8885. [PMID: 28911099] |
| [3] | Begoña Carrasco et al. (2015) Bacillus subtilis RecO and SsbA are crucial for RecA-mediated recombinational DNA repair. Nucleic Acids Research 43(12):5984-97. [PMID: 26001966] |
| [4] | Tribhuwan Yadav et al. (2014) Roles of Bacillus subtilis DprA and SsbA in RecA-mediated genetic recombination. The Journal of Biological Chemistry 289(40):27640-52. [PMID: 25138221] |
| [5] | Tribhuwan Yadav et al. (2013) Bacillus subtilis DprA recruits RecA onto single-stranded DNA and mediates annealing of complementary strands coated by SsbB and SsbA. The Journal of Biological Chemistry 288(31):22437-50. [PMID: 23779106] |
| [6] | Begoña Carrasco et al. (2008) Bacillus subtilis SsbA and dATP regulate RecA nucleation onto single-stranded DNA. DNA Repair 7(6):990-6. [PMID: 18472308] |
| [7] | Candela Manfredi et al. (2008) Bacillus subtilis RecO nucleates RecA onto SsbA-coated single-stranded DNA. The Journal of Biological Chemistry 283(36):24837-47. [PMID: 18599486] |