Detailed information NTG0000583

Experimentally validated

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: DLJ51_RS09560
• Genome accession: NZ_CP029560
• Coordinates: 1965973..1966368 (-)
• Length: 131 a.a.
• NCBI ID: WP_002962590.1
• Uniprot ID: U2IJE4
• Organism: Streptococcus sobrinus strain NIDR 6715-7
• Function: ssDNA binding DNA processing

Function

XIP increases the expression of the comX, ssbB, and cglA genes in strain NIDR 6715-7.

Genomic Context

Location: 1960973..1971368

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DLJ51_RS09535 (DLJ51_09535)	-	1961130..1961477 (+)	348	WP_019769498.1	DUF975 family protein	-
DLJ51_RS09540 (DLJ51_09540)	groL	1961734..1963359 (-)	1626	WP_109982772.1	chaperonin GroEL	-
DLJ51_RS09545 (DLJ51_09545)	groES	1963578..1963862 (-)	285	WP_019769935.1	co-chaperone GroES	-
DLJ51_RS09550 (DLJ51_09550)	-	1964343..1965137 (-)	795	WP_109982773.1	Cof-type HAD-IIB family hydrolase	-
DLJ51_RS09560 (DLJ51_09560)	ssbB	1965973..1966368 (-)	396	WP_002962590.1	single-stranded DNA-binding protein	Machinery gene
DLJ51_RS09565 (DLJ51_09565)	ytpR	1966481..1967107 (-)	627	WP_109982774.1	YtpR family tRNA-binding protein	-
DLJ51_RS09570 (DLJ51_09570)	-	1967129..1967446 (-)	318	WP_004205745.1	thioredoxin family protein	-
DLJ51_RS09575 (DLJ51_09575)	-	1967439..1967729 (-)	291	WP_004205748.1	DUF4651 domain-containing protein	-
DLJ51_RS09580 (DLJ51_09580)	pepA	1967998..1969065 (+)	1068	WP_019769711.1	glutamyl aminopeptidase	-
DLJ51_RS09585 (DLJ51_09585)	proC	1969127..1969897 (+)	771	WP_019771300.1	pyrroline-5-carboxylate reductase	-
DLJ51_RS09590 (DLJ51_09590)	-	1970275..1971031 (-)	757	Protein_1815	lysostaphin resistance A-like protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comS	ssbB	positive effect
comS	comX	positive effect
comS	comGA/cglA	positive effect

Sequence

Protein

• Length: 131 a.a.
• Molecular weight: 14768.70 Da
• Isoelectric Point: 6.2395

>NTDB_id=583 DLJ51_RS09560 WP_002962590.1 1965973..1966368(-) (ssbB) [Streptococcus sobrinus strain NIDR 6715-7]
MYNKVILIGRLTAAPEMVKTPSNKSVTHITLAVNRRFKTQDGERQADFVNVVFWGKLAESLVSYAGKGSLVSLDGEIRTR
HYEKDGQTHYVTEILAQSFQLLESRAQRALRENNGASDLTDLVLEEEELPF

Nucleotide

• Length: 396 bp

>NTDB_id=583 DLJ51_RS09560 WP_002962590.1 1965973..1966368(-) (ssbB) [Streptococcus sobrinus strain NIDR 6715-7]
ATGTATAACAAAGTCATTCTTATCGGTCGTTTGACAGCAGCTCCCGAGATGGTTAAAACACCCTCGAATAAATCTGTTAC
TCACATTACTCTAGCGGTTAATCGTCGTTTTAAAACTCAGGATGGCGAGCGGCAGGCTGACTTTGTCAATGTTGTTTTCT
GGGGCAAGTTGGCTGAAAGCCTAGTTTCTTATGCCGGCAAGGGCAGTTTGGTTTCCTTAGATGGGGAAATTAGAACCCGC
CACTACGAAAAGGATGGCCAGACCCACTATGTAACTGAAATCCTAGCCCAGTCCTTCCAGCTGCTAGAAAGCCGTGCCCA
ACGTGCCCTGAGGGAAAACAATGGAGCCAGTGACCTAACCGACCTAGTCCTCGAAGAAGAGGAACTCCCTTTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (3-102)

3D structure

• AlphaFold DB: U2IJE4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Streptococcus mutans UA159	78.626	100	0.786
ssbB/cilA	Streptococcus mitis NCTC 12261	71.756	100	0.718
ssbB/cilA	Streptococcus pneumoniae TIGR4	70.992	100	0.71
ssbB/cilA	Streptococcus mitis SK321	70.229	100	0.702
ssbB/cilA	Streptococcus pneumoniae R6	70.229	100	0.702
ssbB/cilA	Streptococcus pneumoniae D39	70.229	100	0.702
ssbB/cilA	Streptococcus pneumoniae Rx1	70.229	100	0.702
ssbB	Lactococcus lactis subsp. cremoris KW2	61.538	100	0.62
ssbB	Bacillus subtilis subsp. subtilis str. 168	45.37	95.575	0.434
ssb	Latilactobacillus sakei subsp. sakei 23K	45.763	90.076	0.412
ssbA	Bacillus subtilis subsp. subtilis str. 168	49.057	80.916	0.397

References

• [1]: J W Li et al. (2021) A Novel Competence Pathway in the Oral Pathogen Streptococcus sobrinus. Journal of Dental Research 100(5):542-548. [PMID: 33876976]