Detailed information NTG1145230

Bioinformatically predicted

Overview

• Name: pilT
• Type: Machinery gene
• Locus tag: DXE37_RS13445
• Genome accession: NZ_LT606951
• Coordinates: 850757..850942 (+)
• Length: 61 a.a.
• NCBI ID: WP_269460291.1
• Uniprot ID: -
• Organism: Polynucleobacter necessarius isolate PPGSP6
• Function: power the assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 845757..855942

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DXE37_RS04660	-	846274..846690 (+)	417	WP_162786189.1	tetratricopeptide repeat protein	-
DXE37_RS04665	-	846642..847094 (+)	453	WP_162786190.1	hypothetical protein	-
DXE37_RS04670	-	847127..848254 (+)	1128	WP_114636745.1	FecR domain-containing protein	-
DXE37_RS04675	-	848664..848900 (+)	237	WP_231971088.1	hypothetical protein	-
DXE37_RS04680	-	848955..849401 (+)	447	WP_114636747.1	hypothetical protein	-
DXE37_RS04685	-	849422..850303 (+)	882	WP_114636748.1	prepilin peptidase	-
DXE37_RS11260	-	850332..850751 (+)	420	WP_197713079.1	hypothetical protein	-
DXE37_RS13445	pilT	850757..850942 (+)	186	WP_269460291.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
DXE37_RS13450	pilT	850911..851123 (+)	213	WP_269460292.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
DXE37_RS12455	pilT	851123..851335 (+)	213	WP_231971091.1	hypothetical protein	Machinery gene
DXE37_RS04695	-	851332..851892 (+)	561	WP_114636749.1	Tfp pilus assembly protein FimT/FimU	-
DXE37_RS04700	-	851892..852278 (+)	387	WP_114636750.1	hypothetical protein	-
DXE37_RS04705	-	852349..852792 (+)	444	WP_114636751.1	PilW family protein	-
DXE37_RS04710	-	853030..853638 (+)	609	WP_114636752.1	PilX N-terminal domain-containing pilus assembly protein	-
DXE37_RS04715	-	853642..855030 (+)	1389	WP_114636753.1	hypothetical protein	-
DXE37_RS13455	-	855055..855489 (+)	435	WP_114636754.1	PilC/PilY family type IV pilus protein	-
DXE37_RS13460	-	855495..855842 (+)	348	WP_162786191.1	PilC/PilY family type IV pilus protein	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 7131.14 Da
• Isoelectric Point: 6.7066

>NTDB_id=1145230 DXE37_RS13445 WP_269460291.1 850757..850942(+) (pilT) [Polynucleobacter necessarius isolate PPGSP6]
MIDRINRTRHEHIITIEDPIEFIHQNQKCVVSQCEVKRDTLSFSSALRASLREDPDVILGR

Nucleotide

• Length: 186 bp

>NTDB_id=1145230 DXE37_RS13445 WP_269460291.1 850757..850942(+) (pilT) [Polynucleobacter necessarius isolate PPGSP6]
ATGATTGATCGAATTAACCGTACTCGTCATGAACATATCATCACGATTGAAGATCCGATTGAGTTTATTCATCAAAACCA
AAAATGCGTTGTATCCCAATGTGAGGTGAAAAGAGATACCTTATCTTTTTCTTCCGCATTACGCGCCTCTTTACGTGAAG
ATCCAGACGTTATCTTGGGTAGGTGA

Domains

Predicted by InterproScan.

• Type II/IV secretion system protein (T2SSE) (5-59)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilT	Legionella pneumophila strain ERS1305867	66.102	96.721	0.639
pilT	Legionella pneumophila strain Lp02	66.102	96.721	0.639
pilT	Pseudomonas stutzeri DSM 10701	64.407	96.721	0.623
pilT	Pseudomonas aeruginosa PAK	64.407	96.721	0.623
pilT	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	62.712	96.721	0.607
pilT	Vibrio cholerae O1 biovar El Tor strain E7946	61.017	96.721	0.59
pilT	Neisseria meningitidis 8013	61.017	96.721	0.59
pilT	Vibrio cholerae strain A1552	61.017	96.721	0.59
pilT	Acinetobacter baumannii D1279779	61.017	96.721	0.59
pilT	Acinetobacter baumannii strain A118	61.017	96.721	0.59
pilT	Acinetobacter nosocomialis M2	61.017	96.721	0.59
pilT	Acinetobacter baylyi ADP1	61.017	96.721	0.59
pilT	Neisseria gonorrhoeae MS11	59.322	96.721	0.574
pilU	Pseudomonas stutzeri DSM 10701	59.322	96.721	0.574
pilU	Acinetobacter baylyi ADP1	55.932	96.721	0.541
pilU	Vibrio cholerae strain A1552	53.704	88.525	0.475
pilB	Haemophilus influenzae 86-028NP	44.231	85.246	0.377
pilB	Acinetobacter baylyi ADP1	41.071	91.803	0.377
pilB/pilB1	Synechocystis sp. PCC 6803	44.898	80.328	0.361