NTDB

Overview

Name	pilA2	Type	Machinery gene
Locus tag	OXA88_RS08985	Genome accession	NZ_CP113436
Coordinates	2027520..2027930 (-)	Length	136 a.a.
NCBI ID	WP_016356941.1	Uniprot ID	-
Organism	Legionella pneumophila strain PATHC021
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2022520..2032930

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OXA88_RS08970 (OXA88_08970)	letS	2022840..2025572 (+)	2733	WP_010947629.1	two-component system sensor histidine kinase LetS	Regulator
OXA88_RS08975 (OXA88_08975)	-	2025669..2026913 (+)	1245	WP_010947630.1	6-phosphofructokinase	-
OXA88_RS08980 (OXA88_08980)	pilA2	2026910..2027323 (-)	414	WP_015444381.1	pilin	Machinery gene
OXA88_RS08985 (OXA88_08985)	pilA2	2027520..2027930 (-)	411	WP_016356941.1	pilin	Machinery gene
OXA88_RS08990 (OXA88_08990)	-	2028233..2028550 (+)	318	WP_010947633.1	BolA family protein	-
OXA88_RS08995 (OXA88_08995)	-	2028625..2030046 (+)	1422	WP_010947634.1	APC family permease	-
OXA88_RS09000 (OXA88_09000)	-	2030177..2031607 (-)	1431	WP_010947635.1	cellulase family glycosylhydrolase	-
OXA88_RS09005 (OXA88_09005)	kdsB	2031853..2032605 (-)	753	WP_010947636.1	3-deoxy-manno-octulosonate cytidylyltransferase	-
OXA88_RS09010 (OXA88_09010)	-	2032602..2032781 (-)	180	WP_010947637.1	Trm112 family protein	-

Sequence

Protein

Download Length: 136 a.a. Molecular weight: 13953.16 Da Isoelectric Point: 8.4715

                                >NTDB_id=762120 OXA88_RS08985 WP_016356941.1 2027520..2027930(-) (pilA2) [Legionella pneumophila strain PATHC021]

MRQKGFTLIELMIVVAIIGILAAIAIPAYQDYTIRARVTEGLTLADSAKLAVSETAITNNALPPTQAATGYVSPAATPNV

QSIAIGANGVITITYTASAGGGTIVMTPTLQANGDVTWTCTGGTLLAKYRPASCRP

Nucleotide

Download Length: 411 bp

                                >NTDB_id=762120 OXA88_RS08985 WP_016356941.1 2027520..2027930(-) (pilA2) [Legionella pneumophila strain PATHC021]

ATGAGACAAAAGGGTTTTACTTTAATTGAATTGATGATAGTCGTAGCGATTATCGGTATTTTGGCAGCAATCGCTATACC

AGCCTATCAAGATTACACAATACGAGCTCGTGTTACGGAAGGTCTGACCTTGGCAGATTCTGCAAAACTTGCCGTATCTG

AAACGGCTATTACCAACAACGCGTTACCACCTACTCAGGCTGCAACGGGCTACGTGTCTCCCGCAGCTACGCCCAATGTA

CAATCAATTGCTATTGGTGCCAACGGTGTGATTACCATAACATATACCGCTTCAGCAGGTGGTGGTACCATAGTTATGAC

CCCAACCTTACAAGCTAACGGTGATGTAACCTGGACTTGTACGGGTGGTACATTATTGGCCAAATACCGACCTGCCAGTT

GCAGACCATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(2-25)

Pilin (bacterial filament) (Pilin)

(35-135)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA2	Legionella pneumophila str. Paris	97.794	100	0.978
pilA2	Legionella pneumophila strain ERS1305867	97.794	100	0.978
pilA	Ralstonia pseudosolanacearum GMI1000	48.447	100	0.574
comP	Acinetobacter baylyi ADP1	53.103	100	0.566
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	36.413	100	0.493
pilA/pilA1	Eikenella corrodens VA1	39.873	100	0.463
pilE	Neisseria gonorrhoeae strain FA1090	38.217	100	0.441
pilA	Haemophilus influenzae 86-028NP	40.816	100	0.441
pilE	Neisseria gonorrhoeae MS11	37.821	100	0.434
pilA/pilAI	Pseudomonas stutzeri DSM 10701	42.963	99.265	0.426
pilA	Pseudomonas aeruginosa PAK	39.189	100	0.426
pilA	Acinetobacter baumannii strain A118	39.041	100	0.419
pilA	Haemophilus influenzae Rd KW20	40.741	99.265	0.404
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.855	100	0.404
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.762	100	0.397
pilA	Vibrio cholerae strain A1552	37.762	100	0.397
pilA	Vibrio cholerae C6706	37.762	100	0.397
pilA	Glaesserella parasuis strain SC1401	38.636	97.059	0.375

Detailed information NTG0762120