NTDB

Overview

Name	comP	Type	Machinery gene
Locus tag	N5P21_RS28025	Genome accession	NZ_CP104727
Coordinates	6382406..6382804 (-)	Length	132 a.a.
NCBI ID	WP_261746925.1	Uniprot ID	-
Organism	Pseudomonas citronellolis strain G5.80
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 6377406..6387804

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
N5P21_RS28005 (N5P21_28025)	-	6377552..6378625 (-)	1074	WP_261746922.1	diguanylate cyclase	-
N5P21_RS28015 (N5P21_28035)	-	6378866..6380437 (-)	1572	WP_261746923.1	O-antigen ligase	-
N5P21_RS28020 (N5P21_28040)	-	6380450..6382312 (-)	1863	WP_261746924.1	sulfatase-like hydrolase/transferase	-
N5P21_RS28025 (N5P21_28045)	comP	6382406..6382804 (-)	399	WP_261746925.1	pilin	Machinery gene
N5P21_RS28030 (N5P21_28050)	pilB	6383026..6384729 (+)	1704	WP_261746926.1	type IV-A pilus assembly ATPase PilB	Machinery gene
N5P21_RS28035 (N5P21_28055)	-	6384733..6385951 (+)	1219	Protein_5551	type II secretion system F family protein	-
N5P21_RS28040 (N5P21_28060)	pilD	6385955..6386827 (+)	873	WP_261746927.1	A24 family peptidase	Machinery gene
N5P21_RS28045 (N5P21_28065)	coaE	6386901..6387509 (+)	609	WP_009617624.1	dephospho-CoA kinase	-
N5P21_RS28050 (N5P21_28070)	yacG	6387506..6387715 (+)	210	WP_043272268.1	DNA gyrase inhibitor YacG	-

Sequence

Protein

Download Length: 132 a.a. Molecular weight: 13211.15 Da Isoelectric Point: 4.9218

                                >NTDB_id=731602 N5P21_RS28025 WP_261746925.1 6382406..6382804(-) (comP) [Pseudomonas citronellolis strain G5.80]

MKAQKGFTLIELMIVVAIIGILAAIALPAYQDYTVRARVSEGLVIASGAKATVAENIATDAADNCAGVNTGLTGRTTLSC

AAGTITVAVDAGSTTVTLALAPTASSTGVTWACSTSSDVKYVPAECRTATTP

Nucleotide

Download Length: 399 bp

                                >NTDB_id=731602 N5P21_RS28025 WP_261746925.1 6382406..6382804(-) (comP) [Pseudomonas citronellolis strain G5.80]

ATGAAAGCTCAGAAAGGTTTCACTCTGATCGAACTCATGATCGTCGTAGCGATCATTGGTATCCTGGCCGCCATTGCCCT

GCCGGCTTACCAAGACTACACCGTTCGTGCGCGTGTTTCCGAAGGCTTGGTCATCGCTAGCGGCGCCAAGGCTACCGTTG

CTGAAAACATTGCAACTGATGCTGCTGATAACTGCGCAGGGGTTAACACTGGCCTGACAGGCCGCACCACTCTGTCTTGC

GCTGCTGGCACCATCACCGTTGCTGTCGATGCTGGCAGCACCACTGTGACCCTCGCTCTGGCTCCTACCGCCAGCAGTAC

CGGCGTTACCTGGGCATGCTCCACTTCGTCCGATGTGAAATATGTGCCGGCTGAATGCCGCACTGCCACCACTCCGTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(35-127)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comP	Acinetobacter baylyi ADP1	52.74	100	0.583
pilA	Ralstonia pseudosolanacearum GMI1000	45.283	100	0.545
pilA2	Legionella pneumophila str. Paris	48.872	100	0.492
pilA2	Legionella pneumophila strain ERS1305867	48.872	100	0.492
pilA/pilA1	Eikenella corrodens VA1	41.06	100	0.47
pilA	Acinetobacter baumannii strain A118	41.259	100	0.447
pilE	Neisseria gonorrhoeae strain FA1090	37.342	100	0.447
pilA/pilAI	Pseudomonas stutzeri DSM 10701	41.844	100	0.447
pilA	Vibrio campbellii strain DS40M4	38.158	100	0.439
pilA	Haemophilus influenzae 86-028NP	39.85	100	0.402
pilA	Pseudomonas aeruginosa PAK	35.811	100	0.402
pilA	Vibrio cholerae C6706	37.063	100	0.402
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.063	100	0.402
pilA	Vibrio cholerae strain A1552	37.063	100	0.402
pilA/pilAII	Pseudomonas stutzeri DSM 10701	37.956	100	0.394
pilA	Glaesserella parasuis strain SC1401	34.266	100	0.371

Detailed information NTG0731602