NTDB

Overview

Name	pilA2	Type	Machinery gene
Locus tag	MUU77_RS04455	Genome accession	NZ_CP095187
Coordinates	976084..976497 (-)	Length	137 a.a.
NCBI ID	WP_280640360.1	Uniprot ID	-
Organism	Pseudoxanthomonas sp. F37
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	960408..975976	976084..976497	flank	108

Gene organization within MGE regions

Location: 960408..976497

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUU77_RS04390 (MUU77_04390)	-	960801..961226 (+)	426	WP_245092010.1	transposase	-
MUU77_RS04395 (MUU77_04395)	coaE	961650..962267 (-)	618	WP_245092012.1	dephospho-CoA kinase	-
MUU77_RS04400 (MUU77_04400)	pilD	962301..963164 (-)	864	WP_187573334.1	A24 family peptidase	Machinery gene
MUU77_RS04405 (MUU77_04405)	pilC	963174..964430 (-)	1257	WP_245094214.1	type II secretion system F family protein	Machinery gene
MUU77_RS04410 (MUU77_04410)	pilB	964728..966470 (-)	1743	WP_245092015.1	type IV-A pilus assembly ATPase PilB	Machinery gene
MUU77_RS04415 (MUU77_04415)	-	966685..967533 (+)	849	WP_245092019.1	glycosyltransferase family 2 protein	-
MUU77_RS04420 (MUU77_04420)	-	967548..968777 (+)	1230	WP_245092023.1	glycosyltransferase family 4 protein	-
MUU77_RS04425 (MUU77_04425)	-	968817..970007 (+)	1191	WP_245092025.1	oligosaccharide flippase family protein	-
MUU77_RS04430 (MUU77_04430)	-	969988..971118 (-)	1131	WP_245092027.1	glycosyltransferase	-
MUU77_RS04435 (MUU77_04435)	-	971125..971994 (-)	870	WP_245092029.1	FkbM family methyltransferase	-
MUU77_RS04440 (MUU77_04440)	-	971991..972776 (-)	786	WP_245092031.1	class I SAM-dependent methyltransferase	-
MUU77_RS04445 (MUU77_04445)	-	972879..973973 (+)	1095	WP_245092033.1	glycosyltransferase family 4 protein	-
MUU77_RS04450 (MUU77_04450)	-	974030..975964 (-)	1935	WP_245092035.1	hypothetical protein	-
MUU77_RS04455 (MUU77_04455)	pilA2	976084..976497 (-)	414	WP_280640360.1	pilin	Machinery gene

Sequence

Protein

Download Length: 137 a.a. Molecular weight: 14325.49 Da Isoelectric Point: 4.9006

                                >NTDB_id=676033 MUU77_RS04455 WP_280640360.1 976084..976497(-) (pilA2) [Pseudoxanthomonas sp. F37]

MKKNMQGFTLIELMIVIAILGILLAIAIPAYQDYTVRAKVSEGLNLAASPKLAVAEYAISNNAWPTEAQSGYTFAATSIV

NDISIGANGQIVITYQTAEVPGGGTINLTPDTTVAGVTWVCAAGSLPTKYTPSSCRN

Nucleotide

Download Length: 414 bp

                                >NTDB_id=676033 MUU77_RS04455 WP_280640360.1 976084..976497(-) (pilA2) [Pseudoxanthomonas sp. F37]

ATGAAGAAGAACATGCAGGGCTTCACCCTGATCGAACTGATGATCGTCATCGCCATCCTGGGCATCCTGCTGGCCATCGC

GATTCCGGCCTATCAGGATTACACCGTCCGCGCCAAGGTCTCGGAAGGTCTGAACCTGGCAGCCTCGCCGAAGCTGGCCG

TCGCCGAGTACGCGATTTCCAACAACGCGTGGCCGACCGAAGCTCAGTCGGGCTACACCTTCGCCGCCACCTCGATCGTC

AACGACATTTCGATCGGCGCCAATGGCCAGATCGTCATCACCTATCAAACTGCGGAAGTCCCGGGCGGCGGCACCATCAA

CCTGACGCCGGACACCACCGTGGCTGGCGTGACCTGGGTCTGCGCGGCTGGCAGCCTGCCGACCAAGTACACCCCGTCCA

GCTGCCGCAACTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-27)

Pilin (bacterial filament) (Pilin)

(36-136)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA2	Legionella pneumophila str. Paris	62.5	99.27	0.62
pilA2	Legionella pneumophila strain ERS1305867	62.5	99.27	0.62
pilA	Ralstonia pseudosolanacearum GMI1000	43.976	100	0.533
comP	Acinetobacter baylyi ADP1	47.917	100	0.504
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	35.052	100	0.496
pilE	Neisseria gonorrhoeae strain FA1090	37.975	100	0.438
pilE	Neisseria gonorrhoeae MS11	37.58	100	0.431
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40.426	100	0.416
pilA/pilA1	Eikenella corrodens VA1	35.897	100	0.409
pilA/pilAII	Pseudomonas stutzeri DSM 10701	38.732	100	0.401
pilA	Acinetobacter baumannii strain A118	37.681	100	0.38
pilA	Haemophilus influenzae Rd KW20	42.276	89.781	0.38
pilA	Vibrio parahaemolyticus RIMD 2210633	38.346	97.08	0.372
pilA	Vibrio cholerae C6706	34.483	100	0.365
pilA	Vibrio cholerae strain A1552	34.483	100	0.365
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	34.483	100	0.365

Detailed information NTG0676033