Detailed information NTG0386625

Bioinformatically predicted

Overview

• Name: pilV
• Type: Machinery gene
• Locus tag: F1729_RS28460
• Genome accession: NZ_CP043931
• Coordinates: 7504527..7504640 (+)
• Length: 37 a.a.
• NCBI ID: WP_155367955.1
• Uniprot ID: -
• Organism: Gimesia maris strain DSM 8797
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 7499527..7509640

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
F1729_RS28445 (F1729_28295)	-	7501089..7502027 (+)	939	WP_002648701.1	DUF1559 domain-containing protein	-
F1729_RS28450 (F1729_28300)	-	7502055..7502471 (+)	417	WP_002648702.1	carboxypeptidase-like regulatory domain-containing protein	-
F1729_RS28455 (F1729_28305)	-	7502673..7504184 (+)	1512	WP_002648703.1	SGNH/GDSL hydrolase family protein	-
F1729_RS28460	pilV	7504527..7504640 (+)	114	WP_155367955.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
F1729_RS28465 (F1729_28310)	-	7504653..7505489 (+)	837	Protein_5664	DUF1559 domain-containing protein	-
F1729_RS28470 (F1729_28315)	-	7505600..7506037 (+)	438	WP_002648706.1	carboxypeptidase-like regulatory domain-containing protein	-
F1729_RS28475 (F1729_28320)	-	7506251..7508668 (+)	2418	WP_002648707.1	c-type cytochrome	-

Sequence

Protein

• Length: 37 a.a.
• Molecular weight: 3918.86 Da
• Isoelectric Point: 9.8490

>NTDB_id=386625 F1729_RS28460 WP_155367955.1 7504527..7504640(+) (pilV) [Gimesia maris strain DSM 8797]
MTSAPSLSTRRGFTLIELLVVIAIIAILIALLLPAVQ

Nucleotide

• Length: 114 bp

>NTDB_id=386625 F1729_RS28460 WP_155367955.1 7504527..7504640(+) (pilV) [Gimesia maris strain DSM 8797]
ATGACAAGCGCACCATCATTATCCACCAGAAGAGGCTTTACGCTGATTGAATTGCTGGTCGTGATTGCGATTATCGCGAT
CCTGATTGCATTACTGTTACCCGCCGTTCAGTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-33)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA/pilAII	Pseudomonas stutzeri DSM 10701	60.606	89.189	0.541
pilA/pilA1	Eikenella corrodens VA1	67.857	75.676	0.514
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	70.37	72.973	0.514
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	63.333	81.081	0.514
pilA/pilA1	Synechocystis sp. PCC 6803	61.29	83.784	0.514
pilA	Vibrio campbellii strain DS40M4	64.286	75.676	0.486
pilA/pilAI	Pseudomonas stutzeri DSM 10701	64.286	75.676	0.486
pilE	Neisseria gonorrhoeae MS11	60	81.081	0.486
pilE	Neisseria gonorrhoeae strain FA1090	60	81.081	0.486
comF	Acinetobacter baylyi ADP1	54.839	83.784	0.459
fimT	Acinetobacter baylyi ADP1	70.833	64.865	0.459
pilA	Ralstonia pseudosolanacearum GMI1000	57.143	75.676	0.432
pilA	Vibrio parahaemolyticus RIMD 2210633	57.143	75.676	0.432
pilY2	Acinetobacter baumannii D1279779	51.613	83.784	0.432
pilA	Acinetobacter baumannii strain A118	51.613	83.784	0.432
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	76.19	56.757	0.432
xcpW	Acinetobacter baumannii D1279779	53.333	81.081	0.432
pilA	Vibrio cholerae C6706	50	75.676	0.378
comGD	Latilactobacillus sakei subsp. sakei 23K	56	67.568	0.378
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	50	75.676	0.378
pilA	Vibrio cholerae strain A1552	50	75.676	0.378