Detailed information
Bioinformatically predicted
Overview
| Name | comX/sigX | Type | Regulator |
| Locus tag | DSN71_RS00575 | Genome accession | NZ_CP030845 |
| Coordinates | 78415..78894 (+) | Length | 159 a.a. |
| NCBI ID | WP_001204194.1 | Uniprot ID | A0AAV3JNR5 |
| Organism | Streptococcus agalactiae strain S73 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 79073..120423 | 78415..78894 | flank | 179 |
Gene organization within MGE regions
Location: 78415..120423
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DSN71_RS00575 (DSN71_00575) | comX/sigX | 78415..78894 (+) | 480 | WP_001204194.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| DSN71_RS00580 (DSN71_00580) | - | 79073..80170 (-) | 1098 | WP_000570848.1 | site-specific integrase | - |
| DSN71_RS00585 (DSN71_00585) | - | 80347..80556 (-) | 210 | WP_000520183.1 | TM2 domain-containing protein | - |
| DSN71_RS00590 (DSN71_00590) | - | 80609..80989 (-) | 381 | WP_000686776.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DSN71_RS00595 (DSN71_00595) | - | 80979..81338 (-) | 360 | WP_000207087.1 | helix-turn-helix domain-containing protein | - |
| DSN71_RS00600 (DSN71_00600) | - | 81527..81727 (+) | 201 | WP_001875236.1 | helix-turn-helix transcriptional regulator | - |
| DSN71_RS00605 (DSN71_00605) | - | 81775..82503 (+) | 729 | WP_017647877.1 | phage antirepressor KilAC domain-containing protein | - |
| DSN71_RS10935 | - | 82536..82694 (+) | 159 | WP_017647876.1 | hypothetical protein | - |
| DSN71_RS10895 | - | 82691..82984 (-) | 294 | WP_001104373.1 | hypothetical protein | - |
| DSN71_RS00610 (DSN71_00610) | - | 83113..83370 (+) | 258 | WP_001191791.1 | hypothetical protein | - |
| DSN71_RS10940 | - | 83400..83543 (+) | 144 | WP_017647875.1 | hypothetical protein | - |
| DSN71_RS00615 (DSN71_00615) | - | 83572..84330 (+) | 759 | WP_000546751.1 | DnaD domain protein | - |
| DSN71_RS00620 (DSN71_00620) | - | 84317..85099 (+) | 783 | WP_000600244.1 | ATP-binding protein | - |
| DSN71_RS10945 | - | 85090..85233 (+) | 144 | WP_017647874.1 | hypothetical protein | - |
| DSN71_RS00625 (DSN71_00625) | - | 85226..85501 (+) | 276 | WP_017647873.1 | hypothetical protein | - |
| DSN71_RS00630 (DSN71_00630) | - | 85488..85742 (+) | 255 | WP_017647872.1 | hypothetical protein | - |
| DSN71_RS10950 (DSN71_00635) | - | 85745..85906 (+) | 162 | WP_017647871.1 | hypothetical protein | - |
| DSN71_RS00640 (DSN71_00640) | - | 85907..86860 (+) | 954 | WP_000064172.1 | RecT family recombinase | - |
| DSN71_RS00645 (DSN71_00645) | - | 86857..87654 (+) | 798 | WP_017647870.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DSN71_RS00650 (DSN71_00650) | - | 87817..88014 (+) | 198 | WP_017647869.1 | hypothetical protein | - |
| DSN71_RS00655 (DSN71_00655) | - | 88004..88480 (+) | 477 | WP_017647868.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DSN71_RS00660 (DSN71_00660) | - | 88470..88817 (+) | 348 | WP_017647867.1 | hypothetical protein | - |
| DSN71_RS00665 (DSN71_00665) | - | 88829..89125 (+) | 297 | WP_017647866.1 | nucleotide modification associated domain-containing protein | - |
| DSN71_RS10955 | - | 89109..89267 (+) | 159 | WP_017647865.1 | hypothetical protein | - |
| DSN71_RS00670 (DSN71_00670) | - | 89264..89647 (+) | 384 | WP_017647864.1 | YopX family protein | - |
| DSN71_RS10960 (DSN71_00675) | - | 89644..89808 (+) | 165 | WP_017647863.1 | hypothetical protein | - |
| DSN71_RS00680 (DSN71_00680) | - | 89805..90074 (+) | 270 | WP_017647862.1 | hypothetical protein | - |
| DSN71_RS00685 (DSN71_00685) | - | 90077..90562 (+) | 486 | WP_017647861.1 | class I SAM-dependent methyltransferase | - |
| DSN71_RS00690 (DSN71_00690) | - | 90552..91058 (+) | 507 | WP_231450180.1 | hypothetical protein | - |
| DSN71_RS00695 (DSN71_00695) | - | 91062..91631 (+) | 570 | WP_017647859.1 | DUF1642 domain-containing protein | - |
| DSN71_RS00700 (DSN71_00700) | - | 91652..91951 (+) | 300 | WP_001105090.1 | hypothetical protein | - |
| DSN71_RS00705 (DSN71_00705) | - | 91969..92235 (+) | 267 | WP_017647858.1 | hypothetical protein | - |
| DSN71_RS00710 (DSN71_00710) | - | 92625..93059 (+) | 435 | WP_000142570.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DSN71_RS00720 (DSN71_00720) | - | 94272..94649 (-) | 378 | WP_017647857.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DSN71_RS00725 (DSN71_00725) | - | 94701..94886 (-) | 186 | WP_001132272.1 | type II toxin-antitoxin system HicA family toxin | - |
| DSN71_RS00730 (DSN71_00730) | - | 95042..95491 (+) | 450 | WP_229295347.1 | terminase small subunit | - |
| DSN71_RS00735 (DSN71_00735) | - | 95478..96719 (+) | 1242 | WP_017647856.1 | PBSX family phage terminase large subunit | - |
| DSN71_RS00740 (DSN71_00740) | - | 96732..98225 (+) | 1494 | WP_017647855.1 | phage portal protein | - |
| DSN71_RS00745 (DSN71_00745) | - | 98209..99180 (+) | 972 | WP_017647854.1 | minor capsid protein | - |
| DSN71_RS00750 (DSN71_00750) | - | 99397..99975 (+) | 579 | WP_017647853.1 | DUF4355 domain-containing protein | - |
| DSN71_RS00755 (DSN71_00755) | - | 99985..100368 (+) | 384 | WP_001042771.1 | head decoration protein | - |
| DSN71_RS00760 (DSN71_00760) | - | 100368..101420 (+) | 1053 | WP_001185213.1 | major capsid protein | - |
| DSN71_RS00765 (DSN71_00765) | - | 101433..101687 (+) | 255 | WP_001229661.1 | HeH/LEM domain-containing protein | - |
| DSN71_RS00770 (DSN71_00770) | - | 101703..102056 (+) | 354 | WP_017647852.1 | phage head-tail connector protein | - |
| DSN71_RS00775 (DSN71_00775) | - | 102053..102352 (+) | 300 | WP_017647851.1 | hypothetical protein | - |
| DSN71_RS00780 (DSN71_00780) | - | 102345..102728 (+) | 384 | WP_017647850.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DSN71_RS00785 (DSN71_00785) | - | 102725..103111 (+) | 387 | WP_017647849.1 | DUF3168 domain-containing protein | - |
| DSN71_RS00790 (DSN71_00790) | - | 103120..103605 (+) | 486 | WP_017647848.1 | phage major tail protein, TP901-1 family | - |
| DSN71_RS00795 (DSN71_00795) | - | 103721..104080 (+) | 360 | WP_017647847.1 | tail assembly chaperone | - |
| DSN71_RS00800 (DSN71_00800) | - | 104182..104460 (+) | 279 | WP_025194532.1 | hypothetical protein | - |
| DSN71_RS00805 (DSN71_00805) | - | 104453..107101 (+) | 2649 | WP_017647846.1 | phage tail tape measure protein | - |
| DSN71_RS00810 (DSN71_00810) | - | 107102..108664 (+) | 1563 | WP_017647845.1 | distal tail protein Dit | - |
| DSN71_RS00815 (DSN71_00815) | - | 108655..113622 (+) | 4968 | WP_017647844.1 | glucosaminidase domain-containing protein | - |
| DSN71_RS00820 (DSN71_00820) | - | 113623..115626 (+) | 2004 | WP_017647843.1 | DUF859 family phage minor structural protein | - |
| DSN71_RS00825 (DSN71_00825) | - | 115638..116030 (+) | 393 | WP_000889196.1 | DUF1366 domain-containing protein | - |
| DSN71_RS11145 | - | 116053..116181 (+) | 129 | WP_017647842.1 | hypothetical protein | - |
| DSN71_RS00830 (DSN71_00830) | - | 116190..116492 (+) | 303 | WP_017647841.1 | hypothetical protein | - |
| DSN71_RS00835 (DSN71_00835) | - | 116485..116712 (+) | 228 | WP_000609111.1 | phage holin | - |
| DSN71_RS00840 (DSN71_00840) | - | 116838..118172 (+) | 1335 | WP_017647840.1 | GH25 family lysozyme | - |
| DSN71_RS00845 (DSN71_00845) | - | 118316..118567 (-) | 252 | WP_000455662.1 | hypothetical protein | - |
| DSN71_RS10965 | - | 118708..118854 (-) | 147 | WP_001030869.1 | hypothetical protein | - |
| DSN71_RS00850 (DSN71_00850) | - | 119004..119213 (+) | 210 | WP_000424774.1 | helix-turn-helix transcriptional regulator | - |
| DSN71_RS00855 (DSN71_00855) | prx | 119336..119518 (+) | 183 | WP_017647839.1 | hypothetical protein | Regulator |
| DSN71_RS00860 (DSN71_00860) | - | 119731..120423 (+) | 693 | WP_000049272.1 | histidine phosphatase family protein | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 19447.28 Da Isoelectric Point: 6.2639
>NTDB_id=301811 DSN71_RS00575 WP_001204194.1 78415..78894(+) (comX/sigX) [Streptococcus agalactiae strain S73]
MRDFEELFDKVKPIVMKLRRNYFVQLWEYDDWIQEGRIVLFRLLEEHPYLLDNESKLFIYFKTKFSNYLNDVLRHQDCQK
RQFNKMPYEEISEVSHYVKSKGLVLDDYIAYRDTLTKVEETLSDIDKEKFEKLISGERFAGKKQFIRDIQPFFNAFKAD
MRDFEELFDKVKPIVMKLRRNYFVQLWEYDDWIQEGRIVLFRLLEEHPYLLDNESKLFIYFKTKFSNYLNDVLRHQDCQK
RQFNKMPYEEISEVSHYVKSKGLVLDDYIAYRDTLTKVEETLSDIDKEKFEKLISGERFAGKKQFIRDIQPFFNAFKAD
Nucleotide
Download Length: 480 bp
>NTDB_id=301811 DSN71_RS00575 WP_001204194.1 78415..78894(+) (comX/sigX) [Streptococcus agalactiae strain S73]
TTGAGAGATTTTGAGGAGTTGTTTGATAAAGTAAAGCCAATCGTAATGAAGCTGAGAAGAAATTATTTTGTTCAACTTTG
GGAATATGATGATTGGATTCAAGAAGGACGTATTGTACTTTTTAGGTTGCTTGAAGAGCATCCGTATTTATTGGATAATG
AAAGCAAACTATTCATTTACTTTAAAACAAAATTTTCAAATTATTTAAACGATGTATTAAGACACCAAGATTGTCAAAAG
CGACAATTTAATAAAATGCCTTATGAAGAAATCAGTGAAGTTAGTCACTATGTTAAGAGTAAAGGACTAGTTTTAGATGA
CTATATTGCTTATCGTGATACTTTAACAAAAGTGGAAGAAACTTTGTCAGATATTGATAAAGAAAAATTTGAAAAACTGA
TTAGTGGTGAACGTTTTGCGGGGAAGAAACAATTCATACGAGATATTCAACCTTTTTTCAATGCTTTTAAAGCGGATTAA
TTGAGAGATTTTGAGGAGTTGTTTGATAAAGTAAAGCCAATCGTAATGAAGCTGAGAAGAAATTATTTTGTTCAACTTTG
GGAATATGATGATTGGATTCAAGAAGGACGTATTGTACTTTTTAGGTTGCTTGAAGAGCATCCGTATTTATTGGATAATG
AAAGCAAACTATTCATTTACTTTAAAACAAAATTTTCAAATTATTTAAACGATGTATTAAGACACCAAGATTGTCAAAAG
CGACAATTTAATAAAATGCCTTATGAAGAAATCAGTGAAGTTAGTCACTATGTTAAGAGTAAAGGACTAGTTTTAGATGA
CTATATTGCTTATCGTGATACTTTAACAAAAGTGGAAGAAACTTTGTCAGATATTGATAAAGAAAAATTTGAAAAACTGA
TTAGTGGTGAACGTTTTGCGGGGAAGAAACAATTCATACGAGATATTCAACCTTTTTTCAATGCTTTTAAAGCGGATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.