Detailed information NTG0299408

Bioinformatically predicted

Overview

• Name: comX/sigX
• Type: Regulator
• Locus tag: DP111_RS00595
• Genome accession: NZ_CP030124
• Coordinates: 91863..92333 (+)
• Length: 156 a.a.
• NCBI ID: WP_002936602.1
• Uniprot ID: A0A075SE61
• Organism: Streptococcus suis strain SH1510
• Function: activate transcription of late competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	91022..91345	91863..92333	flank	518

Gene organization within MGE regions

Location: 91022..92333

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DP111_RS00595 (DP111_00595)	comX/sigX	91863..92333 (+)	471	WP_002936602.1	sigma-70 family RNA polymerase sigma factor	Regulator

Sequence

Protein

• Length: 156 a.a.
• Molecular weight: 19072.97 Da
• Isoelectric Point: 8.9339

>NTDB_id=299408 DP111_RS00595 WP_002936602.1 91863..92333(+) (comX/sigX) [Streptococcus suis strain SH1510]
MEFEKVYASVKGIVNKARKEFYIKLWDRDDWEQEGMMTLFELLEAQPWLVDEQVQLYCYFKVKFRNRIKDRIRKQESQKR
KFDRMPHEDIHELSHAIQSPGLINDELLMLRGALRDYRKNLSNDQLDKYEKLISGQCFNGRREMIRDLQIHLKDFR

Nucleotide

• Length: 471 bp

>NTDB_id=299408 DP111_RS00595 WP_002936602.1 91863..92333(+) (comX/sigX) [Streptococcus suis strain SH1510]
ATGGAATTCGAAAAAGTGTACGCAAGCGTCAAAGGTATTGTAAATAAGGCTCGAAAAGAGTTTTACATTAAACTATGGGA
TCGAGATGATTGGGAACAAGAAGGAATGATGACCTTGTTTGAATTATTAGAAGCTCAACCGTGGCTAGTTGATGAACAAG
TTCAATTATATTGTTATTTTAAAGTTAAGTTCAGAAATCGAATCAAGGATCGTATCCGCAAACAGGAAAGTCAAAAACGC
AAGTTTGACCGTATGCCACATGAAGATATTCACGAATTATCTCACGCAATACAATCACCGGGATTAATAAACGATGAACT
ATTAATGCTAAGAGGTGCCTTGAGAGATTATCGAAAAAATCTGAGTAATGATCAACTTGATAAATACGAAAAATTAATTA
GCGGACAATGTTTTAATGGTCGCCGTGAAATGATACGTGATTTACAAATTCATTTGAAAGACTTTCGCTAA

Domains

No domain identified.

3D structure

• AlphaFold DB: A0A075SE61

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX/sigX	Streptococcus suis D9	100	100	1
comX/sigX	Streptococcus suis isolate S10	99.359	100	0.994
comX/sigX	Streptococcus suis P1/7	99.359	100	0.994
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	49.032	99.359	0.487
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	49.032	99.359	0.487
comX/comX1	Streptococcus pneumoniae TIGR4	46.358	96.795	0.449
comX/comX2	Streptococcus pneumoniae TIGR4	46.358	96.795	0.449
comX/sigX/comX2/sigX2	Streptococcus mitis NCTC 12261	45.752	98.077	0.449
comX/sigX/comX1/sigX1	Streptococcus mitis SK321	45.098	98.077	0.442
comX/sigX/comX2/sigX2	Streptococcus mitis SK321	45.098	98.077	0.442
comX/comX1	Streptococcus pneumoniae Rx1	45.695	96.795	0.442
comX/comX2	Streptococcus pneumoniae D39	45.695	96.795	0.442
comX/comX1	Streptococcus pneumoniae D39	45.695	96.795	0.442
comX/comX2	Streptococcus pneumoniae R6	45.695	96.795	0.442
comX/comX1	Streptococcus pneumoniae R6	45.695	96.795	0.442
comX/comX2	Streptococcus pneumoniae Rx1	45.695	96.795	0.442
comX/sigX/comX1/sigX1	Streptococcus mitis NCTC 12261	44.444	98.077	0.436
comX/sigX	Streptococcus mutans UA159	43.226	99.359	0.429
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	40.645	99.359	0.404
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	40.645	99.359	0.404
comX	Streptococcus sobrinus strain NIDR 6715-7	40.523	98.077	0.397
comX	Streptococcus thermophilus LMG 18311	40.523	98.077	0.397
comX	Streptococcus thermophilus LMD-9	40.523	98.077	0.397
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	40	99.359	0.397
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	40	99.359	0.397
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	40	99.359	0.397
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	40	99.359	0.397
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	38.854	100	0.391
comX	Streptococcus salivarius SK126	39.869	98.077	0.391
comX/sigX	Streptococcus salivarius strain HSISS4	39.869	98.077	0.391